UniProt UniProt http://www.uniprot.org Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1. Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1. Genomics 2000 imex curation Tsui S., Dai T., Roettger S., Schempp W., Salido EC., Yen PH. pyen@rei.edu Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tsui S., Dai T., Roettger S., Schempp W., Salido EC., Yen PH. pyen@rei.edu Accepted 2021-OCT-04 AT 16:16 BST AT 16:16 BST by MGT Human testis MATCHMAKER cDNA Genomics 2000 Only protein-protein interactions imex curation imex curation Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1. Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1. Genomics 2000 imex curation Tsui S., Dai T., Roettger S., Schempp W., Salido EC., Yen PH. pyen@rei.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tsui S., Dai T., Roettger S., Schempp W., Salido EC., Yen PH. I have deliberately ignored the apparent DAZAP1 and DAZAP2 interaction in Fig. 2 as the author makes no mention of it so presumably thinks its contamination from the heavy DAZAP2 band. pyen@rei.edu Accepted 2021-OCT-04 AT 16:16 BST AT 16:16 BST by MGT Genomics 2000 Only protein-protein interactions imex curation imex curation Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1. Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1. Genomics 2000 imex curation Tsui S., Dai T., Roettger S., Schempp W., Salido EC., Yen PH. pyen@rei.edu Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tsui S., Dai T., Roettger S., Schempp W., Salido EC., Yen PH. RNA molecules immobilized on agarose beads pyen@rei.edu Accepted 2021-OCT-04 AT 16:16 BST AT 16:16 BST by MGT Human testis MATCHMAKER cDNA Genomics 2000 Only protein-protein interactions imex curation imex curation dazp1_human DAZ-associated protein 1 DAZAP1 Deleted in azoospermia-associated protein 1 protein protein human Homo sapiens Human MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR CFEB42903F4D5AFB dazp2_human DAZ-associated protein 2 Deleted in azoospermia-associated protein 2 DAZAP2 KIAA0058 protein protein human Homo sapiens Human MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW 49F1B6D281E24AAC polya_rna Homopolymeric adenosine rna ribonucleic acid RNA rna in vitro In vitro polyu rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) polyg Homopolymeric guanosine rna ribonucleic acid RNA rna in vitro In vitro dazl_human Deleted in azoospermia-like DAZ-like autosomal Deleted in azoospermia-like 1 DAZ homolog SPGY-like-autosomal DAZL DAZH DAZL1 DAZLA SPGYLA protein protein human Homo sapiens Human MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV 21B360739B35B95F daz1_human Deleted in azoospermia protein 1 DAZ1 DAZ SPGY protein protein human Homo sapiens Human MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD 341CB19EFC82F757 daz1-dazap1-1 2 10 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig. 2 daz1-dazap2-1 2 10 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2 daz1-dazap1-2 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association daz1-dazap2-2 1 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association daz1-dazl-2 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined daz repeat regions required to bind necessary binding region required to bind range range range range 10 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 2, 3 dazap1-daz1-2 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined daz repeat regions required to bind necessary binding region required to bind range range range range 4 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 2, 3 daz1-daz1-1 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined daz repeat regions required to bind necessary binding region required to bind range range range range rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 10 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figs. 2, 3 dazap1-daz1-1 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined daz repeat regions required to bind necessary binding region required to bind range range range range 4 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 2, 3 dazap2-daz1-1 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined daz repeat regions required to bind necessary binding region required to bind range range range range 5 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 2, 3 dazap2-dazl-1 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined daz repeat regions required to bind necessary binding region required to bind range range range range 5 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 2, 3 polyu-dazap1-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rna binding regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4A, 4B, 4C polyu-daz1-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4A polyg-daz1-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 8 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4A, 4B polyg-dazap1-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rna binding regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 8 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4A, C polya_rna-dazap1-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 6 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4A