DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. The Journal of cell biology 1997 imex curation von Mollard GF., Nothwehr SF., Stevens TH. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot von Mollard GF., Nothwehr SF., Stevens TH. Accepted 2020-MAY-15 AT 11:58 BST AT 11:58 BST by ORCHARD The Journal of cell biology 1997 imex curation The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. The Journal of cell biology 1997 imex curation von Mollard GF., Nothwehr SF., Stevens TH. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence von Mollard GF., Nothwehr SF., Stevens TH. Accepted 2020-MAY-15 AT 11:58 BST AT 11:58 BST by ORCHARD The Journal of cell biology 1997 imex curation The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. The Journal of cell biology 1997 imex curation von Mollard GF., Nothwehr SF., Stevens TH. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot von Mollard GF., Nothwehr SF., Stevens TH. Accepted 2020-MAY-15 AT 11:58 BST AT 11:58 BST by ORCHARD The Journal of cell biology 1997 imex curation pep12_yeast Syntaxin PEP12 PEP12 Vacuolar protein sorting-associated protein 6 Vacuolar protein-targeting protein 13 Carboxypeptidase Y-deficient protein 12 VPS6 VPT13 OR26.29 YOR036W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKAMRYQKRTSRWRVYLLIVLLVMLLFIFLIMKL D9F5711339DA1CDA D9F5711339DA1CDA sed5_yeast Integral membrane protein SED5 SED5 YLR026C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNIKDRTSEFQQSVLSYKKRNKNFREQQRERLQEKESENFANNTTGNGKSVSEFQKKASGIAHEISSTAQLLSKLAVLAKRKPMFNDNPVEIAELSFLIKRKIYAIEQSLVQLSQLKKTDVNGNTSNQSSKQPSAVQHSKNVVNLLNTQMKNISGSFKDVLEERQRLEMANKDRWQKLTTDTGHAPADDQTQSNHAADLTTYNNSNPFMTSLLDESSEKNNNSSNQGELSFPQNDSQLMLMEEGQLSNNVYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLKYFDRIKSNRWLAAKVFFIIFVFFVIWVLVN B3192B57269A0B83 B3192B57269A0B83 vps10_yeast Vacuolar protein sorting/targeting protein VPS10 PEP1 Vacuolar carboxypeptidase sorting receptor VPS10 Carboxypeptidase Y receptor Vacuolar protein sorting-associated protein 10 Vacuolar protein-targeting protein 1 Carboxypeptidase Y-deficient protein 1 Sortilin VPS10 VPS10 VPT1 YBL03.22 YBL0302 YBL017C protein protein yeast Saccharomyces cerevisiae Baker's yeast MILLHFVYSLWALLLIPLTNAEEFTPKVTKTIAQDSFDILSFDDSNTLIRKQDTSVTISFDDGETWEKVEGIEGEITWIYIDPFNRHDRAVATAMNGSYLYITNDQGKSWERITLPDSGESISPRECYIETHPLNKNYFLAKCNYCEKTEVNNDNEENSGDEEGQFEIFNITRCTDKVFASNDGGKSFSEIKSSLERNENSPISISDCGFAKTSKDSDLESSDTSIICLFQNMQLIMDEFSSPYTESKLVLTTDWGKSLKEFDQFKDKVVNGYRILKSHMVVLTQGDRYNDMSSMDVWVSNDLSNFKMAYMPTQLRHSMQGEIYEDAMGRIILPMSRERSDQEEDKGIVSEILISDSQGLKFSPIPWTANEVFGYINFYQPTYLKGTMIASLYPLSRRRNRKGKAKGVKSKGVTKISVDNGLTWTMLKVVDPDNADSFDCDITDFENCSLQNMFYTREGSTPTAGILMTTGIVGDGSVFDWGDQRTFISRDGGLTWKLAFDFPCLYAVGDYGNVIVAIPYNADEDDDPQSEFYYSLDQGKTWTEYQLETTIYPNEVMNTTPDGSGAKFILNGFTLAHMDGTTNFIYAIDFSTAFNDKTCEENDFEDWNLAEGKCVNGVKYKIRRRKQDAQCLVKKVFEDLQLFETACDKCTEADYECAFEFVRDATGKCVPDYNLIVLSDVCDKTKKKTVPVKPLQLVKGDKCKKPMTVKSVDISCEGVPKKGTNDKEIVVTENKFDFKIQFYQYFDTVTDESLLMINSRGEAYISHDGGQTIKRFDSNGETIIEVVFNPYYNSSAYLFGSKGSIFSTHDRGYSFMTAKLPEARQLGMPLDFNAKAQDTFIYYGGKNCESILSPECHAVAYLTNDGGETFTEMLDNAIHCEFAGSLFKYPSNEDMVMCQVKEKSSQTRSLVSSTDFFQDDKNTVFENIIGYLSTGGYIIVAVPHENNELRAYVTIDGTEFAEAKFPYDEDVGKQEAFTILESEKGSIFLHLATNLVPGRDFGNLLKSNSNGTSFVTLEHAVNRNTFGYVDFEKIQGLEGIILTNIVSNSDKVAENKEDKQLKTKITFNEGSDWNFLKPPKRDSEGKKFSCSSKSLDECSLHLHGYTERKDIRDTYSSGSALGMMFGVGNVGPNLLPYKECSTFFTTDGGETWAEVKKTPHQWEYGDHGGILVLVPENSETDSISYSTDFGKTWKDYKFCADKVLVKDITTVPRDSALRFLLFGEAADIGGSSFRTYTIDFRNIFERQCDFDITGKESADYKYSPLGSKSNCLFGHQTEFLRKTDENCFIGNIPLSEFSRNIKNCSCTRQDFECDYNFYKANDGTCKLVKGLSPANAADVCKKEPDLIEYFESSGYRKIPLSTCEGGLKLDAPSSPHACPGKEKEFKEKYSVSAGPFAFIFISILLIIFFAAWFVYDRGIRRNGGFARFGEIRLGDDGLIENNNTDRVVNNIVKSGFYVFSNIGSLLQHTKTNIAHAISKIRGRFGNRTGPSYSSLIHDQFLDEADDLLAGHDEDANDLSSFMDQGSNFEIEEDDVPTLEEEHTSYTDQPTTTDVPDTLPEGNEENIDRPDSTAPSNENQ C778A0400612ECF4 C778A0400612ECF4 vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 E55B4DA3B40FAD67 pep1-vti1-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association pep12-vti1p-1 3 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig 9 sed5p-vti1p-1 1 5 unspecified role unspecified role unspecified role unspecified role purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 9B pep12-vti1p-2 1 4 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 9B