DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of V-ATPase from the mammalian brain. Structure of V-ATPase from the mammalian brain. Science (New York, N.Y.) 2020 imex curation Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca Accepted 2020-JUL-13 AT 05:02 BST AT 05:02 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation Structure of V-ATPase from the mammalian brain. Structure of V-ATPase from the mammalian brain. Science (New York, N.Y.) 2020 imex curation Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single structure determination identification by structure determination identification by structure determination structure determination Abbas YM., Wu D., Bueler SA., Robinson CV., Rubinstein JL. john.rubinstein@utoronto.ca Accepted 2020-JUL-13 AT 05:02 BST AT 05:02 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation d4a133_rat H(+)-transporting two-sector ATPase rCG_52629 Atp6v1a protein protein rat Rattus norvegicus (Rat) Rat MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRSRGSVTYIAPPGNYDASDVVLELEFEGVKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED 5C6FE68005530B50 d3zim6_rat Rnasek protein protein rat Rattus norvegicus (Rat) Rat MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR B6B39A5CFDDB87EB vatc1_rat V-type proton ATPase subunit C 1 Atp6v1c1 Vacuolar proton pump subunit C 1 protein protein rat Rattus norvegicus (Rat) Rat MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHKARENKFIVRDFQYNEEEMRADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK FEFADA5FF3DB65BA p25286-1 V-type proton ATPase 116 kDa subunit a1 Atp6v0a1 Atp6n1 Vpp1 Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit Vacuolar adenosine triphosphatase subunit Ac116 Vacuolar proton pump subunit 1 Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1 protein protein rat Rattus norvegicus (Rat) Rat MGELFRSEEMTLAQLFLQSEAAYCCVSELEELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE D25FAD918638D7EE vatl_rat V-type proton ATPase 16 kDa proteolipid subunit Atp6v0c Atp6c Atp6l Atpl Vacuolar proton pump 16 kDa proteolipid subunit protein protein rat Rattus norvegicus (Rat) Rat MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 880C280C5AEB0C5C vate1_rat V-type proton ATPase subunit E 1 Atp6v1e1 Vacuolar proton pump subunit E 1 protein protein rat Rattus norvegicus (Rat) Rat MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 5DCAAC2C77F09A08 q5zww6_legph lpg0968 protein protein legph Legionella pneumophila subsp. pneumophila MSFIKVGIKMGGLTSEQYHSQVVGKIGYIARCMQTIDPENNLKKIREDYQDVLIWAEKNYRFEEILEASKSGKCPNDLDALSRRSLILQELLRLVSSISPFKMKLDLIESQYEKMKQHVNLWKSDYHVKLNQLNQLTDYLKNAAPTPKNNFLRAMTSVLQMQIAQYGITEDNEGINQLFKLGLHLLAMANEKIDEQYHLFKGYVKDQPEESPFEGILPAEDQKILVKTMIDYAMPKLSSKVLQDKLSALSSSDVLTKTLLDSIDRIVKENEKLNALSKVKLGKFGLDIREIEVIYSQALKISPQDALQYTAQQCDAQLLSMAFPDSQNYIIESISNKKVKTIAELIHSKEFIYQIIKTEVFKQVDPNEKIRLQAATELYQLLGRIMDKQINLFTKMNLEQINEYIQTKTKAILDKIPERVELLTFMGFEIPTFKGIETLMTDISHSQDNETLAIAQEFYTNIKNAKNQLLGDKLIEDITPQDVEKFFNQCSQYGSEAAEKLADNRPVLTKIADILTAIARWAISLIGFNTPPQFLAPTRTCVDQVSDEITKIKLKLEDTLGSLQKVQEESLSL C527E5694FCC00A2 renr_rat Renin receptor Atp6ap2 Atp6ip2 ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 Renin/prorenin receptor protein protein rat Rattus norvegicus (Rat) Rat MAVLVVLLSSLVSSALANEFSILRSPGSVVFRNGNWPIPGDRIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATIMVTVKGVDKLALPTGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLNSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDELGKRYGEDSEQFRDASRILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLVRKSRTILETKQENTQSPYNLAYKYNLEYSVVFNLVLWIMTGLALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD 9845898BC3E260CF vas1_rat V-type proton ATPase subunit S1 V-ATPase S1 accessory protein V-ATPase Ac45 subunit C7-1 protein Atp6ap1 Atp6ip1 Atp6s1 Vacuolar proton pump subunit S1 protein protein rat Rattus norvegicus (Rat) Rat MMAATVVSRIRTGTRWAPVLWLLLSLVAVAAAVAAEQQVPLVLWSSDRDLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLESEDVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARYWFTMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDRKGPTITLTQIV 6086B8C368A81CC9 vatf_rat V-type proton ATPase subunit F Vacuolar proton pump subunit F V-ATPase 14 kDa subunit Atp6v1f Atp6s14 Vatf protein protein rat Rattus norvegicus (Rat) Rat MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR 9FFA95BD2667AA2A q6p503_rat V-type proton ATPase subunit D Atp6v1d V-type proton ATPase subunit d Vacuolar proton pump subunit D rCG_61537 protein protein rat Rattus norvegicus (Rat) Rat MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKSEKDLERRRAAGEVMEPANLLAEEKDEDLLFE 41870EB2A03E8B1C va0e2_rat V-type proton ATPase subunit e 2 Atp6v0e2 Vacuolar proton pump subunit e 2 protein protein rat Rattus norvegicus (Rat) Rat MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE E84EC3CB4304BB45 q8r2h0_rat V-type proton ATPase subunit G Atp6v1g2 Aif1 Bat1a Cdk2ap1-ps2 Cdk2ap1-ps3 Cdk2ap1-ps4 Cdk2ap1-ps5 Cdk2ap1-ps6 E230034O05Rik LOC224733l-3 LOC224733l-4 LOC224733l-5 LOC224733l-6 LOC224733l-7 LOC224733l-8 Lst1 RT1-CE12 RT1-CE3 RT1-CE5 RT1-CE6 RT1-CE8 RT1-CE9 Sacm2l-ps3 Sacm2l-ps4 Sacm2l-ps5 Sacm2l-ps6 Sacm2l-ps7 Tnf rCG_38311 protein protein rat Rattus norvegicus (Rat) Rat MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLTQLLGMVCDVRPQVHPNYRITV 4245D9D0DFEB54CD q5m7t6_rat V-type proton ATPase subunit Atp6v0d1 rCG_51062 protein protein rat Rattus norvegicus (Rat) Rat MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF 62CDF67B982124C9 b0k022_rat Atp6v0b Atp6v0b_predicted rCG_50448 protein protein rat Rattus norvegicus (Rat) Rat MTGLELLYLGIFVAFWACMIVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD 323CD18BED0AF9B4 vatb2_rat V-type proton ATPase subunit B, brain isoform Vacuolar proton pump subunit B 2 Endomembrane proton pump 58 kDa subunit Atp6v1b2 Atp6b2 Vat2 protein protein rat Rattus norvegicus (Rat) Rat MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH E116BF9A36EEF36B atp6ap1-atp6ap2-1 2 10 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 7 structure determination identification by structure determination identification by structure determination structure determination monoclonal immunost monoclonal antibody immunostaining monoclonal immunost experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 4 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 14 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 16 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 11 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 17 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 6 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 15 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 12 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 5 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 13 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 18 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 3 structure determination identification by structure determination identification by structure determination structure determination mudpit multidimensional protein identification technology mudpit experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 1d, Fig S3 atp6v1a-atp6v1b2-3 1 9 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 15 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 12 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 5 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 13 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 18 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 3 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 1c atp6v1a-q5zww6_legph-1 1 9 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 3 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 1c atp6v1a-atp6v1b2-1 1 9 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 15 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 12 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 5 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 13 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 18 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 3 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 1c atp6v1a-atp6v1b2-2 1 9 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 1-278 binding region 1-278 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 15 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 12 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 13 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 18 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] 3 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Fig 1c