IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Journal of immunology (Baltimore, Md. : 1950) 2020 imex curation Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-plasma homo sapiens blood plasma plasma blood plasma elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk Accepted 2021-APR-06 AT 13:56 BST AT 13:56 BST by MARTA Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Journal of immunology (Baltimore, Md. : 1950) 2020 imex curation Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk Accepted 2021-APR-06 AT 13:56 BST AT 13:56 BST by MARTA Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Journal of immunology (Baltimore, Md. : 1950) 2020 imex curation Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. in vitro experiment as both proteins are secreted (extracellular). peter.garred@regionh.dk Accepted 2021-APR-06 AT 13:56 BST AT 13:56 BST by MARTA Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Journal of immunology (Baltimore, Md. : 1950) 2020 imex curation Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk Accepted 2021-APR-06 AT 13:56 BST AT 13:56 BST by MARTA Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Journal of immunology (Baltimore, Md. : 1950) 2020 imex curation Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column elisa enzyme linked immunosorbent assay ELISA ELISA elisa Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk Accepted 2021-APR-06 AT 13:56 BST AT 13:56 BST by MARTA Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Circulating Ficolin-2 and Ficolin-3 Form Heterocomplexes. Journal of immunology (Baltimore, Md. : 1950) 2020 imex curation Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jarlhelt I., Pilely K., Clausen JB., Skjoedt MO., Bayarri-Olmos R., Garred P. peter.garred@regionh.dk Accepted 2021-APR-06 AT 13:56 BST AT 13:56 BST by MARTA Journal of immunology (Baltimore, Md. : 1950) 2020 Only protein-protein interactions imex curation imex curation fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region D363029846CCB3C9 fcn3_human Ficolin-3 FCN3 FCNH HAKA1 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen protein protein human Homo sapiens Human MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 5CB8A7D3668FA364 fcn2-fcn3-1 1 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1C fcn3-fcn2-2 1 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1D The figure legend text appears to have entered the antibody target for capture and detection the wrong-way around. weak interaction fcn2-fcn3-3 4 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 5 non-reducing conditions Under nonreducing conditions, a characteristic ladder-like banding pattern is visible with all the oligomeric forms of ficolin-23. I have shown the dimer (1:1) -M. Wt = ~60kDa, here, and the multimers (0:0) stoich. Do not know how we are meant to show the several multimers, so have entered as "0" stoich. fcn2-fcn3-4 3 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 4C, 7C Collagenase fcn3-fcn2-3 3 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 4D weak interaction fcn2-fcn3-6 2 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1C fcn3-fcn2-5 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1D The figure legend text appears to have entered the antibody target for capture and detection the wrong-way around. weak interaction fcn2-fcn3-2 4 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3, 5 non-reducing conditions Under nonreducing conditions, a characteristic ladder-like banding pattern is visible with all the oligomeric forms of ficolin-23; high molecular mass oligomers are shown here. fcn2-fcn3-5 6 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 5 Under nonreducing conditions, a characteristic ladder-like banding pattern is visible with all the oligomeric forms of ficolin-23; high molecular mass oligomers are shown here. non-reducing conditions. fcn2-fcn3-7 6 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 5 Under nonreducing conditions, a characteristic ladder-like banding pattern is visible with all the oligomeric forms of ficolin-23. non-reducing conditions. I have shown the dimer (1:1) -M. Wt = ~60kDa, here, and the multimers (0:0) stoich. Do not know how we are meant to show the several multimers, so have entered as "0" stoich. fcn2-fcn3-8 5 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level conditioned medium conditioned medium crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 6 A wide span of oligomeric forms was seen.