IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Journal of cellular and molecular medicine 2020 imex curation Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. cyq@bjmu.edu.cn 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro array technology array technology tag visualisation tag visualisation Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. For results from Supp. Fig 2C:- WFA and "lentil" lectin only give weak signals, and DBA + AAA cannot be identified.-so no interactions entered. Lectins found in "Manual" from suppliers web site. Only lectins that are identifiable and produce a strong positive signal have been entered here as interactors. cyq@bjmu.edu.cn Accepted 2021-FEB-02 AT 09:25 GMT AT 09:25 GMT by PPORRAS Journal of cellular and molecular medicine 2020 Only protein-protein interactions imex curation imex curation Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Journal of cellular and molecular medicine 2020 imex curation Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. cyq@bjmu.edu.cn 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. cyq@bjmu.edu.cn Accepted 2021-FEB-02 AT 09:25 GMT AT 09:25 GMT by PPORRAS Journal of cellular and molecular medicine 2020 Only protein-protein interactions imex curation imex curation Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Journal of cellular and molecular medicine 2020 imex curation Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. cyq@bjmu.edu.cn 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. cyq@bjmu.edu.cn Accepted 2021-FEB-02 AT 09:25 GMT AT 09:25 GMT by PPORRAS Journal of cellular and molecular medicine 2020 Only protein-protein interactions imex curation imex curation calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p11226-pro_0000017401 Mannose-binding protein C Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin MBL2 COLEC1 MBL protein protein human Homo sapiens Human ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI 21 248 693BA4AD8B3A7708 a0a2d0tci3_agrcy Galectin protein protein Toadstool Agrocybe cylindracea Pholiota aegerita MDYKDDDDKHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLAKLAAALE 0DB71AC6C541460B phal_phavu Leucoagglutinating phytohemagglutinin DLEC2 protein protein phavu Phaseolus vulgaris French bean MASSKFFTVLFLVLLTHANSSNDIYFNFQRFNETNLILQRDASVSSSGQLRLTNLNGNGEPRVGSLGRAFYSAPIQIWDNTTGTVASFATSFTFNIQVPNNAGPADGLAFALVPVGSQPKDKGGFLGLFDGSNSNFHTVAVEFDTLYNKDWDPTERHIGIDVNSIRSIKTTRWDFVNGENAEVLITYDSSTNLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATTGINKGNVETNDVLSWSFASKLSDGTTSEGLNLANLVLNKIL 9DBF7D3077A067D7 mals_maaam Seed leukoagglutinin Leukoagglutinating lectin MAL Seed leucoagglutinin MAL protein protein Amur maackia Maackia amurensis MATSNSKPTQVLLATFLTFFFLLLNNVNSSDELSFTINNFVPNEADLLFQGEASVSSTGVLQLTRVENGQPQKYSVGRALYAAPVRIWDNTTGSVASFSTSFTFVVKAPNPDITSDGLAFYLAPPDSQIPSGSVSKYLGLFNNSNSDSSNQIVAVELDTYFAHSYDPWDPNYRHIGIDVNGIESIKTVQWDWINGGVAFATITYLAPNKTLIASLVYPSNQTTFSVAASVDLKEILPEWVRVGFSAATGYPTEVETHDVLSWSFTSTLEANCDAATENNVHIARYTA BE84411950B0BA7E fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 184D24B371B251AB q15485-pro_0000009139 Ficolin-2 37 kDa elastin-binding protein Collagen/fibrinogen domain-containing protein 2 EBP-37 Ficolin-B Ficolin-beta Hucolin L-ficolin Serum lectin p35 FCN2 FCNL protein protein human Homo sapiens Human LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA 26 313 288505F85171831A lec_baupu Lectin protein protein Camel's foot tree Bauhinia purpurea Phanera purpurea MLLYNSKSYVLQLIFITLLLTQLNKVKSTSSTLTGFTFPNFWSNTQENGTEIIFLGNATYTPGALRLTRIGEDGIPLKSNAGQASYSRPVFLWDSTGHVASFYTSFSFIVRSIDVPHITADGFAFFLAPVDSSVKDYGGCLGLFRYKTATDPSKNQVVAVEFDTWPNTEWSDLRYPHIGINVNSTVSVATTRWDNDDAYVTKSTAHITYDATSKIITVLLTYDNGRHYQLSHVVDLPKILPERVRIGFSGGTGFNETQYILSWSFTSTLNSTKISALTQKLRSSASYSSM 9DBC144630D2C768 v5yn37_phavu protein protein phavu Phaseolus vulgaris French bean MASSNLLSLALFLVLLTHANSASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHWDPKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLSDGTTSEALNLANFALNQIL 897C61B4356FD021 q75wt9_9aphy psl1a protein protein Polyporus squamosus Polyporus squamosus MSFQGHGIYYIASAYVANTRLALSEDSSANKSPDVIISSDAVDPLNNLWLIEPVGEADTYTVRNAFAGSYMDLAGHAATDGTAIIGYRPTGGDNQKWIISQINDVWKIKSKETGTFVTLLNGDGGGTGTVVGWQNITNNTSQNWTFQKLSQTGANVHATLLACPALRQDFKSYLSDGLYLVLTRDQISSIWQASGLGSTPWRSEIFDCDDFATVFKGAVAKWGNENFKANGFALLCGLMFGSKSSGAHAYNWFVERGNFSTVTFFEPQNGTYSANAWDYKAYFGLF F7577367FA89508F mlec_human Malectin MLEC KIAA0152 protein protein human Homo sapiens Human MLGAWAVEGTAVALLRLLLLLLPPAIRGPGLGVAGVAGAAGAGLPESVIWAVNAGGEAHVDVHGIHFRKDPLEGRVGRASDYGMKLPILRSNPEDQILYQTERYNEETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVFDVRLNGHVVVKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYIMAGTVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNSSLMFPILVAFGVFIPTLFCLCRL 448D673A5A1A8F09 lec_vicvi Lectin B4 VVLB4 protein protein Hairy vetch Vicia villosa SESTSFSFTNFNPNQENLILQEDALVNSKGTLELTKNGKPVPESLGRNCTTLASFTTSFSFVMSAPNSLDVADGLAFFLAPPDTQPQKRGGFLGLFKDRKHDISYQSVAVEFDTYSNVWDPNTTHIGIDTNTIESKKITPFDMVYGEKILFASLVFPVSQDILPEYVRVGFSATTGLNEGVVETH E375F10559F29A8C leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI DIP protein P17931 original sequence version: 132 DIP protein P17931 original sequence version: 181 C49DDF6D67AE0C88 o75636-1 Ficolin-3 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCN3 FCNH HAKA1 protein protein human Homo sapiens Human MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 5CB8A7D3668FA364 leg2_human Galectin-2 Beta-galactoside-binding lectin L-14-II LGALS2 Lactose-binding lectin 2 S-Lac lectin 2 HL14 protein protein human Homo sapiens Human MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE mint This protein binds beta-galactoside. Its physiological function is not yet known E30B8768630A2ACB urom_human Uromodulin UMOD Tamm-Horsfall urinary glycoprotein protein protein human Homo sapiens Human MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ D26A07A76353AE48 a0a089zwn7_datst dsa-b protein protein Jimsonweed Datura stramonium Common thornapple MMRMRHTAISLLALALFFLKVSAKLSLPFYLPANETLGLEVGNTSAQPYSEERCGIQAGGRRCPNGMCCSYTGWCGNTSKHCNPNNCQSQCSGPFPRDRCGWQADGRSCPTGVCCSECGWCGTTSAYCAPSNCQDQCEKLPSPSPPPPSPPPPPPSPSPPPPPPSPPPPPSYPQGRCGRQAGGRKCPTGVCCSLSGWCGTTSAYCNPDICQSQCSGPFPQGRCGWQADGGVCPTGVCCSLSGWCGTTSAYCAPGHCQSQCPTLIKNGIRGIESFLLNAI 1B76F54FD7A66C73 leg1_human Galectin-1 Lectin galactoside-binding soluble 1 Beta-galactoside-binding lectin L-14-I S-Lac lectin 1 Galaptin 14 kDa lectin HPL HBL Putative MAPK-activating protein PM12 LGALS1 Lactose-binding lectin 1 14 kDa laminin-binding protein protein protein human Homo sapiens Human MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD DIP protein P09382 original sequence version: null DIP protein P09382 original sequence version: 111 2FBB8D7A1FC0F1F9 q9bwp8-pro_0000315044 Collectin-11 Collectin kidney protein 1 UNQ596/PRO1182 COLEC11 protein protein human Homo sapiens Human QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM 26 271 567DC0696A492AB2 colec11-umod-1 3 19 unspecified role unspecified role prey prey purified purified human-urine human urine urine urine 22 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 1A/C,5 Deglycosylation of THP by PNGaseF, endoglycosidase H (Endo H) and fucosidase;removal of fucose completely ablated the binding between the two proteins. Binding strength of CL‐11 to THP collected from AKI patients was higher when compared to normal controls especially at 2.5 µg/mL of THP. (results were not statistically significant at any other THP concentration.) colec11-umod-2 2 19 unspecified role unspecified role neutral component neutral component purified purified region fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 22 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 1B colec11-umod-3 3 4 unspecified role unspecified role ancillary ancillary chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role prey prey purified purified human-urine human urine urine urine 5 unspecified role unspecified role bait bait purified purified human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 3A colec11-umod-4 3 19 unspecified role unspecified role prey prey purified purified human-urine human urine urine urine 9 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 3B fcn1-umod-1 3 19 unspecified role unspecified role prey prey purified purified human-urine human urine urine urine 10 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 3B fcn2-umod-1 3 19 unspecified role unspecified role prey prey purified purified human-urine human urine urine urine 17 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 3B a0a2d0tci3_agrcy-umod-1 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 6 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2, number 1 Carbohydrate specificity:alpha-2-3 Sialic Acid lec_baupu-umod-1 1 11 unspecified role unspecified role bait bait purified purified baupu-seed baupu seed seed seed 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine direct interaction direct interaction Supp. figure 2, number 2 Carbohydrate specificity:Gal-beta-3GalNAc lec_baupu-umod-2 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 20 unspecified role unspecified role bait bait purified purified datst-seed datst seed seed seed direct interaction direct interaction Supp. figure 2, number 3 Carbohydrate specificity:(GlcNAc) 2-4 lgals1-umod-1 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 21 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2, number 4 Carbohydrate specificity:branched LacNAc, Gal. lgals2-umod-1 1 18 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine direct interaction direct interaction Supp. figure 2, number 5 Carbohydrate specificity:GalNAc_alpha1-3Gal (Blood Group A), branched LacNAc. lgals2-umod-2 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 16 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2, number 6 Carbohydrate specificity:poly LacNAc. mal-umod-1 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 8 unspecified role unspecified role bait bait purified purified maaam-seed maaam seed seed seed direct interaction direct interaction Supp. figure 2, number 7 Carbohydrate specificity:Galbeta4GlcNAc. mlec-umod-1 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 14 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2, number 8 Carbohydrate specificity:Glc 2 -N -biose. mlec-umod-2 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 12 unspecified role unspecified role bait bait purified purified phavu-seed phavu seed seed seed direct interaction direct interaction Supp. figure 2, number 9 Carbohydrate specificity:Galbeta4GlcNAcbeta2Manα6(GlcNAcb4)(GlcNAcbeta4Manα3)Manbeta4. dlec2-umod-1 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 7 unspecified role unspecified role bait bait purified purified phavu-seed phavu seed seed seed direct interaction direct interaction Supp. figure 2, number 10 Carbohydrate specificity:Galbeta4GlcNAcbeta6(GlcNAcbeta2Manalpha3)Manalpha3 dlec2-umod-2 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 13 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2, number 11 Carbohydrate specificity:alpha2-6 Sialic Acid mal-umod-2 1 19 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 15 unspecified role unspecified role bait bait purified purified vicvi-seed vicvi seed seed seed direct interaction direct interaction Supp. figure 2, number 12 Carbohydrate specificity:GalNAc.