IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Turkish journal of biology = Turk biyoloji dergisi 2017 imex curation Akiva İ., Birgül Iyison N. birgul@boun.edu.tr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akiva İ., Birgül Iyison N. birgul@boun.edu.tr Accepted 2020-APR-14 AT 14:30 BST AT 14:30 BST by ORCHARD The detection of BRI3 in supplementary figure 1 was performed with an antibody against BRI3 in addition to an antibody against the tag (GFP). Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Turkish journal of biology = Turk biyoloji dergisi 2017 imex curation Akiva İ., Birgül Iyison N. birgul@boun.edu.tr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Akiva İ., Birgül Iyison N. birgul@boun.edu.tr Accepted 2020-APR-14 AT 14:30 BST AT 14:30 BST by ORCHARD Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Turkish journal of biology = Turk biyoloji dergisi 2017 imex curation Akiva İ., Birgül Iyison N. birgul@boun.edu.tr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akiva İ., Birgül Iyison N. Cotrasformation was performed to confirm positive clones The species identity of the BRI3 construct is not explicitly specified in the manuscript. I have inferred it is encoding for the human protein based on the sequence reported in figure 2. birgul@boun.edu.tr Accepted 2020-APR-14 AT 14:30 BST AT 14:30 BST by ORCHARD Human liver cDNA Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Identification of IFITM3 and MGAT1 as novel interaction partners of BRI3 by yeast two-hybrid screening. Turkish journal of biology = Turk biyoloji dergisi 2017 imex curation Akiva İ., Birgül Iyison N. birgul@boun.edu.tr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Akiva İ., Birgül Iyison N. Interaction between BRI3 isoform b (F5GXW6) and the bait proteins is indicated as weaker as compared to the interaction of BRI3 isoform a. No convincing control of IP efficiency is present. birgul@boun.edu.tr Accepted 2020-APR-14 AT 14:30 BST AT 14:30 BST by ORCHARD The detection of BRI3 in supplementary figure 1 was performed with an antibody against BRI3 in addition to an antibody against the tag (GFP). Turkish journal of biology = Turk biyoloji dergisi 2017 Only protein-protein interactions imex curation imex curation bri3b_human BRI3-binding protein BRI3BP KG19 Cervical cancer 1 proto-oncogene-binding protein KG19 HCCRBP-1 protein protein human Homo sapiens Human MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK DBC7ECB411010F71 ifm3_human Interferon-induced transmembrane protein 3 IFITM3 Dispanin subfamily A member 2b Interferon-inducible protein 1-8U protein protein human Homo sapiens Human MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG mint 9FFB2E4623F7A1DD bri3_human Brain protein I3 BRI3 pRGR2 protein protein human Homo sapiens Human MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA ABBFADD00E91C52C mgat1_human Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase MGAT1 GGNT1 GLCT1 MGAT GLYT1 N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I protein protein human Homo sapiens Human MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQDAEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGYDPSWN Initiates complex N-linked carbohydrate formation. Essential for the conversion of high-mannose to hybrid and complex N-glycans mint homomint 13402302ED69C302 il7ra_human Interleukin-7 receptor subunit alpha IL7R CDw127 protein protein human Homo sapiens Human MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ EF50BF2615EEF50C bri3-ifitm3-1 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed The authors do not mention which isoform has been used to transform the bait strain. physical association physical association 1a, suppl. table 1 bri3-mgat1-1 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 1a, suppl. table 1 bri3-ifitm3-2 4 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3a, suppl.1 bri3-mgat1-2 4 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3a, suppl.1 bri3-bri3bp-1 4 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined There are no specific references to the vectors used for cloning. If the pcDNA3-HA backbone indicated in the manuscript is the following: https://www.addgene.org/browse/sequence/139830/ the HA tag should be at the N-terminus. This consideration is valid for all the HA-tagged constructs. 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3a, suppl.1 bri3-ifitm3-3 4 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b bri3-mgat1-3 4 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b bri3-bri3bp-2 4 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b bri3-ifitm3-4 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined The tag used for detection by confocal microscopy is a DsRed fusion protein. 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4a bri3-mgat1-4 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4a bri3-mgat1-5 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4b bri3-ifitm3-5 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4b bri3-il7r-1 3 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 1a, suppl. table 1 bri3-ifitm3-6 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed The authors do not mention which isoform has been used to transform the bait strain. physical association physical association 1b bri3-mgat1-6 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 1b