IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Interaction of C1q With Pentraxin 3 and IgM Revisited: Mutational Studies With Recombinant C1q Variants. Interaction of C1q With Pentraxin 3 and IgM Revisited: Mutational Studies With Recombinant C1q Variants. Frontiers in immunology 2018 imex curation Bally I., Inforzato A., Dalonneau F., Stravalaci M., Bottazzi B., Gaboriaud C., Thielens NM. nicole.thielens@ibs.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Bally I., Inforzato A., Dalonneau F., Stravalaci M., Bottazzi B., Gaboriaud C., Thielens NM. Rare diseases - Interactions investigated in the context of Rare genetic disease From ref 27 MASP-2 harbours a Ser618Ala mutation. Ser637Ala mutation in C1R has been remapped to aa position 654 according to a more recent publication of the same authors: PMID 31749804 that refers to this manuscript. Mutations in C1q subunits have been remapped adding the signal peptide as reported in Uniprot. Interaction with IgM could not be captured as a unique UniprotAC could not be found. nicole.thielens@ibs.fr Accepted 2020-FEB-18 AT 10:47 GMT AT 10:47 GMT by MGT Frontiers in immunology 2018 Only protein-protein interactions imex curation imex curation Interaction of C1q With Pentraxin 3 and IgM Revisited: Mutational Studies With Recombinant C1q Variants. Interaction of C1q With Pentraxin 3 and IgM Revisited: Mutational Studies With Recombinant C1q Variants. Frontiers in immunology 2018 imex curation Bally I., Inforzato A., Dalonneau F., Stravalaci M., Bottazzi B., Gaboriaud C., Thielens NM. nicole.thielens@ibs.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay antibody detection identification by antibody antibody detection Bally I., Inforzato A., Dalonneau F., Stravalaci M., Bottazzi B., Gaboriaud C., Thielens NM. nicole.thielens@ibs.fr Accepted 2020-FEB-18 AT 10:47 GMT AT 10:47 GMT by MGT Frontiers in immunology 2018 Only protein-protein interactions imex curation imex curation o00187-pro_0000027598 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human TPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF 16 686 42B65EAE62578A55 c1s_human Complement C1s subcomponent C1S C1 esterase Complement component 1 subcomponent s protein protein human Homo sapiens Human MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPKCVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED 85522647A4C47205 ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS 09BCE02E2A62D62A c1r_human Complement C1r subcomponent C1R Complement component 1 subcomponent r protein protein human Homo sapiens Human MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED B45D120201061462 c1qa_human Complement C1q subcomponent subunit A C1QA protein protein human Homo sapiens Human MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA DIP protein P02745 original sequence version: null 8FF6B6AE02D49C4C c1qb_human Complement C1q subcomponent subunit B C1QB protein protein human Homo sapiens Human MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA D80C753C0D430EDC c1qc_human Complement C1q subcomponent subunit C C1QC C1QG protein protein human Homo sapiens Human MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD FA17117EB7ABFC12 cr1-1 2 5 unspecified role unspecified role prey prey purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 7 unspecified role unspecified role prey prey purified purified P00736:p.Ser654Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:46:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser654Ala' strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 18 unspecified role unspecified role bait bait purified purified P02747:p.Lys198Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E 20 Thu Mar 05 22:52:44 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Tue Mar 31 09:57:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Tue Apr 28 11:19:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Mon Jun 29 10:17:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Tue Jun 30 17:24:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys198Glu' P02746:p.Tyr202Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y L 22 Thu Mar 05 22:26:18 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Tue Mar 31 09:41:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Tue Apr 28 11:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Mon Jun 29 10:40:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Tue Jun 30 15:59:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr202Leu' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association Fig.2 A,B,C and Table 1 c1q_human-c1r-1 2 4 unspecified role unspecified role prey prey purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:24:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 18 unspecified role unspecified role bait bait purified purified P02745:p.Lys222_Lys223delinsAspAsp P02745:p.Lys222_Lys223delinsAspAsp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KK DD 31 Thu Mar 05 23:04:10 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Tue Mar 31 10:50:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Tue Apr 28 09:58:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Mon Jun 29 10:22:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Tue Jun 30 17:14:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys222_Lys223delinsAspAsp' P02746:p.Arg135_Arg136delinsAspAsp P02746:p.Arg135_Arg136delinsAspAsp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain RR DD 22 Thu Mar 05 22:46:45 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Tue Mar 31 10:07:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Tue Apr 28 10:55:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Mon Jun 29 09:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Tue Jun 30 19:37:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg135_Arg136delinsAspAsp' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Fig.2 D,E,F and Table 1 c1q_human-masp2-1 2 6 unspecified role unspecified role prey prey purified purified p.Ala48Asp variant variant certain certain sequence position certain certain certain sequence position certain A D crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 18 unspecified role unspecified role bait bait purified purified P02745:p.Lys222_Lys223delinsAspAsp P02745:p.Lys222_Lys223delinsAspAsp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain KK DD 31 Thu Mar 05 22:01:35 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Tue Mar 31 10:03:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Tue Apr 28 11:18:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Mon Jun 29 10:19:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02745:p.Lys222_Lys223delinsAspAsp' Tue Jun 30 16:41:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys222_Lys223delinsAspAsp' P02746:p.Arg135_Arg136delinsAspAsp P02746:p.Arg135_Arg136delinsAspAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RR DD 22 Thu Mar 05 23:27:59 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Tue Mar 31 10:30:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Tue Apr 28 10:49:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Mon Jun 29 10:22:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Arg135_Arg136delinsAspAsp' Tue Jun 30 20:02:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg135_Arg136delinsAspAsp' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 P02747:p.Lys198Glu P02747:p.Lys198Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E 20 Thu Mar 05 23:01:54 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Tue Mar 31 09:50:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Tue Apr 28 10:14:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Mon Jun 29 10:27:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02747:p.Lys198Glu' Tue Jun 30 16:39:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys198Glu' P02746:p.Tyr202Leu P02746:p.Tyr202Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y L 22 Thu Mar 05 23:15:21 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Tue Mar 31 11:05:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Tue Apr 28 10:02:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Mon Jun 29 10:13:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P02746:p.Tyr202Leu' Tue Jun 30 16:25:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr202Leu' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Fig.3 A-E and Table 2 ptx3-c1q-1 3 18 unspecified role unspecified role bait bait purified purified human-serum Homo sapiens serum Serum 6 unspecified role unspecified role prey prey purified purified P26022:p.Ala48Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A D Tue Jun 30 17:04:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala48Asp' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Fig. 5D In this regard, when assayed in solid phase binding experiments, the D48 and A48 alleles had comparable binding to plastic-immobilized C1q at each applied concentration (Figure 5D), indicating that in the described experimental conditions the p.D48A polymorphism does not affect the interaction of PTX3 with C1q. c1q_human Complement component C1q complex C1q Complement 1q C1QA-C1QB-C1QC complex 6xC1QA:6xC1QB:6xC1QC 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 48 54 51 49 55 58 52 73 52 67 58 73 93 64 57 61 67 91 63 60 70 82 66 93 91 69 81 79 72 75 76 78 87 84 90 88 85 97 95 92 96 94 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Complement component C1q deficiency (C1QD) [MONDO:0013343]: a disorder caused by impaired activation of the complement classical pathway. It generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis. coronavirus The complex comprises of six heterotrimeric collagen-like triple helices, formed from triplets of the A, B, and C chains, that associate in their N-terminal half to form a stalk, then diverge to form individual stems, each terminating in a C-terminal globular domain. Each of the six heterotrimeric globular heads or domains is made up of the globular domains from one A, one B, and one C chain, each of which in turn has its own ligand specificity. The six collagen-like stalks appear to be fibril-like and exist in the central region. The collagen-like region and the globular heads can independently interact with a multiplicity of biological structures including pathogen-associated and cell associated molecules, also each of the individual globular head domains is capable of independently interacting with specific ligands. Chains A and B are disulfide-linked whilst the C chain forms a disulfide bond with the C chain of the next strand. Molecular weight 460 kDa. Recognition unit of the classical pathway of complement which associates with the Ca2+ - dependent C1r(2)-C1s(2) tetramer to form C1 (CPX-1920), the first component of the classical complement system. The complex's role in C1 is the recognition of immune complexes, or other molecules, which trigger the classical pathway of the complement system. Independent of complement activation C1q appears to have additional roles in homeostasis and cellular development, superoxide (O2-) production by neutrophils, blood coagulation and neurological synapse pruning. Heterooctadecamer created with intact-jami-dbscripts