UniProt UniProt http://www.uniprot.org Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro lipase assay lipase assay predetermined predetermined participant predetermined Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com Accepted 2020-OCT-07 AT 10:18 BST AT 10:18 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com Accepted 2020-OCT-07 AT 10:18 BST AT 10:18 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com Accepted 2020-OCT-07 AT 10:18 BST AT 10:18 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com Accepted 2020-OCT-07 AT 10:18 BST AT 10:18 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com Accepted 2020-OCT-07 AT 10:18 BST AT 10:18 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Structure of the lipoprotein lipase-GPIHBP1 complex that mediates plasma triglyceride hydrolysis. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M., Birrane G., Beigneux AP., Dwyer B., Strack-Logue B., Kristensen KK., Francone OL., Fong LG., Mertens HDT., Pan CQ., Ploug M., Young SG., Meiyappan M. Rare diseases - Interactions investigated in the context of Rare genetic disease mmeiyappan@shire.com Accepted 2020-OCT-07 AT 10:18 BST AT 10:18 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation lipl_human Lipoprotein lipase LPL LIPD Phospholipase A1 protein protein human Homo sapiens Human MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG FBD00FCD334FB8AA hdbp1_human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 GPIHBP1 HBP1 High density lipoprotein-binding protein 1 protein protein human Homo sapiens Human MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP 89FF61B08A008C70 triolein triolein propane-1,2,3-triyl (9Z,9'Z,9''Z)tris-octadec-9-enoate TG(18:1(9Z)/18:1(9Z)/18:1(9Z))[iso] Trioleoylglyceride Trioleoylglycerol propane-1,2,3-triyl tris[(9Z)-octadec-9-enoate] Oleyl triglyceride (Z)-9-Octadecenoic acid, 1,2,3-propanetriyl ester 1,2,3-tri-(9Z-octadecenoyl)-glycerol Glycerin trioleate Glycerol trioleate Glycerol triolein Glycerol, tri(cis-9-octadecenoate) Glyceryl trioleate Glyceryl-1,2,3-trioleate Oleic acid triglyceride Oleic triglyceride Olein small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gpihbp1-lpl-1 2 7 unspecified role unspecified role neutral component neutral component purified purified P06858:p.Arg324Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig. 1A gpihbp1-lpl-3 2 7 unspecified role unspecified role neutral component neutral component purified purified P06858:p.Arg324Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 1B gpihbp1-lpl-4 5 7 unspecified role unspecified role neutral component neutral component purified purified P06858:p.Arg324Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Table 1 gpihbp1-lpl-5 3 7 unspecified role unspecified role neutral component neutral component purified purified P06858:p.Arg324Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. 3 gpihbp1-lpl-6 6 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed P06858:p.Cys445Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S P06858:p.Met404Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8IV16:p.Trp109Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W S crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. colocalization colocalization Fig. 8A gpihbp1-lpl-7 4 7 unspecified role unspecified role prey prey conditioned medium conditioned medium P06858:p.Cys445Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C Y P06858:p.Met404Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role bait bait purified purified physical association physical association Fig. 8B lpl-triolein-1 1 7 enzyme enzyme unspecified role unspecified role purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06858:p.Cys445Tyr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C Y P06858:p.Met404Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M R 9 enzyme target enzyme target substrate substrate unspecified role unspecified role region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined lipid cleavage lipid cleavage Fig. 8B