UniProt UniProt http://www.uniprot.org Effect of Specific Mutations in Cd300 Complexes Formation; Potential Implication of Cd300f in Multiple Sclerosis. Effect of Specific Mutations in Cd300 Complexes Formation; Potential Implication of Cd300f in Multiple Sclerosis. Scientific reports 2017 imex curation Martínez-Barriocanal Á., Arcas-García A., Magallon-Lorenz M., Ejarque-Ortíz A., Negro-Demontel ML., Comas-Casellas E., Schwartz S., Malhotra S., Montalban X., Peluffo H., Martín M., Comabella M., Sayós J. Rare diseases - Interactions investigated in the context of Rare genetic disease joan.sayos@vhir.org 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Martínez-Barriocanal Á., Arcas-García A., Magallon-Lorenz M., Ejarque-Ortíz A., Negro-Demontel ML., Comas-Casellas E., Schwartz S., Malhotra S., Montalban X., Peluffo H., Martín M., Comabella M., Sayós J. Rare diseases - Interactions investigated in the context of Rare genetic disease joan.sayos@vhir.org Accepted 2021-JAN-05 AT 13:41 GMT AT 13:41 GMT by MGT Scientific reports 2017 Only protein-protein interactions imex curation imex curation clm5_human CMRF35-like molecule 5 CD300LD CD300D CMRF35A4 CD300 antigen-like family member D CMRF35-A4 UNQ9218/PRO28686 protein protein human Homo sapiens Human MWLSPSLLLLILPGYSIAAKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS 5E3A4CB03B473E12 clm2_human CMRF35-like molecule 2 CD300 antigen-like family member E CMRF35-A5 Immune receptor expressed on myeloid cells 2 Polymeric immunoglobulin receptor 2 CD300E CD300LE CLM2 CMRF35A5 IREM2 protein protein human Homo sapiens Human MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPHFLLVVLLKLPLLLSMLGAVFWVNRPQWAPPGR clm1_human CMRF35-like molecule 1 CD300LF CD300 antigen-like family member F CD300F CLM1 IGSF13 IREM1 Immune receptor expressed on myeloid cells 1 Immunoglobulin superfamily member 13 NK inhibitory receptor NKIR UNQ3105/PRO10111 protein protein human Homo sapiens Human MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP mint 27AA95664B82B945 clm6_human CMRF35-like molecule 6 CD300C CMRF35 CMRF35A CMRF35A1 IGSF16 CD300 antigen-like family member C CMRF35-A1 Immunoglobulin superfamily member 16 protein protein human Homo sapiens Human MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ 60C88716D84600D2 clm7_human CMRF35-like molecule 7 CD300LB CD300B CLM7 CMRF35A2 IREM3 LMIR5 TREM5 CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Leukocyte mono-Ig-like receptor 5 Triggering receptor expressed on myeloid cells 5 UNQ2530/PRO6029 protein protein human Homo sapiens Human MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT 2B8027A488B97CAF clm8_human CMRF35-like molecule 8 CD300A CD300 antigen-like family member A CMRF-35-H9 CMRF35-H CMRF35H IGSF12 IRC1/IRC2 Immunoglobulin superfamily member 12 Inhibitory receptor protein 60 NK inhibitory receptor HSPC083 protein protein human Homo sapiens Human MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQLPLLLSLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYANLELLMWPLQEKPAPPREVEVEYSTVASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRKT 978461DA87E86269 cd300c-cd300lb-3 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.[Arg95Gly;Asp97Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R G certain certain sequence position certain certain certain sequence position certain D G Sun Dec 13 19:24:52 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Arg95Gly;Gln97Gly]' A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 20:01:41 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 2A Regarding the CD300b R95G-Q97G mutant:there is no "Q" (Glutamine) at residue 97. There is a "D" (Aspartic acid) at this position. Details of mutations given in Table S1 refer to an N97A mutation, which cannot be found in the main text, and this table does not list either an Q97G or D97G mutant. cd300lb-cd300lb-2 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 19:30:49 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 2B, Fig. 4 cd300lb-cd300lb-3 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 18:39:21 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 2B cd300lb-cd300lb-4 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaGly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 18:50:46 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaGly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 18:49:59 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 2B cd300ld-cd300lb-2 1 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 18:54:25 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 2C cd300e-cd300lb-2 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 19:12:26 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C cd300a-cd300lb-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 18:29:22 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2D cd300lf-cd300lb-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed A8K4G0:p.Glu28_Gln29delinsAlaGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ AG Sun Dec 13 18:33:27 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2D cd300lb-cd300lb-5 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaArg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain EQ AR Mon Mar 01 10:57:51 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A8K4G0:p.[Glu28Ala;Gln29Arg]' 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.[Glu28_Gln29delinsAlaGly;Asn81Ala;Asp84Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain EQ AG Mon Mar 01 11:28:54 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A8K4G0:p.[Glu28Ala;Gln29Gly;Asn81Ala;Asp84Ala]' physical association physical association Fig. 4 cd300lb-cd300lb-6 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed A8K4G0:p.[Asn81Ala;Asp84Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain D A region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 cd300lb-cd300lb-7 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.Glu28_Gln29delinsAlaArg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain EQ AR Mon Mar 01 11:51:50 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A8K4G0:p.[Glu28Ala;Gln29Arg]' 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A8K4G0:p.[Asn81Ala;Asp84Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain N A Sun Dec 13 19:30:49 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 4 cd300lf-cd300lf-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8TDQ1:p.Arg33Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Sun Dec 13 18:33:27 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Q08708:p.[Glu28Ala;Gln29Gly]' physical association physical association Fig. 5C