DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Core Mediator structure at 3.4 Å extends model of transcription initiation complex. Core Mediator structure at 3.4 Å extends model of transcription initiation complex. Nature 2017 imex curation Nozawa K., Schneider TR., Cramer P. pcramer@mpibpc.mpg.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Nozawa K., Schneider TR., Cramer P. pcramer@mpibpc.mpg.de Accepted 2020-NOV-04 AT 11:32 GMT AT 11:32 GMT by LUANA Nature 2017 Only protein-protein interactions imex curation imex curation Core Mediator structure at 3.4 Å extends model of transcription initiation complex. Core Mediator structure at 3.4 Å extends model of transcription initiation complex. Nature 2017 imex curation Nozawa K., Schneider TR., Cramer P. pcramer@mpibpc.mpg.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation schpm Schizosaccharomyces pombe (fission yeast) Fission yeast x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nozawa K., Schneider TR., Cramer P. pcramer@mpibpc.mpg.de Accepted 2020-NOV-04 AT 11:32 GMT AT 11:32 GMT by LUANA Nature 2017 Only protein-protein interactions imex curation imex curation med7_schpo Mediator of RNA polymerase II transcription subunit 7 Mediator complex subunit 7 med7 SPBC14F5.08 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEPNEGVQLFSAFPPPPPYYKLFTRENIEKVISNMEKEAKHEDDANTLQPKTEEEIESLAKLFKKPSCLTSGTYQMFGDTWRLDEAIPSLKEFGIPELYKDIKDGEDEIEVVEYDPKSNAIVGTSFTRVHDYDKNSPIENEKILEDDQHTAMKEKDNESDKTMKDVEEKTEPSLKKEEEDIQMKEPLDSQDTGAVSASSVNEGFRADQKSKDGETSDLIKIPRRAYELRFLSRSLMLNFLELLGIMAKAPEQFPSKVENIRVLLLNLHHLINDYRPHQSRESLIMLLEKQLKHEESQVELLRTHNRQMTETLEKYKSLDFNMEKEGDVIQQLKSSIKKPLSGAEDEQKSRSMFSKNDEKLKKSLELMEDVIKRDLS A2FFA4E9CFAAEE99 med20_schpo Mediator of RNA polymerase II transcription subunit 20 med20 Mediator complex subunit 20 SPAC17G8.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPVHGVIYYSSPSMATFLSPAQDNLVRTYFAQHLKKWVVQYKLYRNAVTPKTLEFLKQNINPSMLACVDEATMIDAEPELEDIIVRTKLWNFRQSFTIEGSIYEVGSFKVAIANVLQKSVWKGILFHVTYDGTESVDLARPIIQEFFLKCFLQNNKSVTPVYESFFNQPRHSLDSKLLLQLFKQRIDTVSQRT 05AD4D96C2452EA0 med8_schpo Mediator of RNA polymerase II transcription subunit 8 med8 sep15 SPBC21.04 Mediator complex subunit 8 Cell separation protein sep15 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEDISTEKTVESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSIYPSLEFPVKEQEPLLTTLLRTKALPEVEEWEANTLQEYEASISSQPKKKEANDAYQKDQLWDQARIIFMEERENYSWFDFVTRRQESEGEFVSQRQLEIDRATEEQNANQMLTDILSFMKSGKR A61A9E49B83A86F0 A61A9E49B83A86F0 med10_schpo Mediator of RNA polymerase II transcription subunit 10 med10 nut2 SPBC31F10.09c Mediator complex subunit 10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLPQDDMTDEMKSLASRLEDTTQAFYDLALIVYNLEDTTPSDAIPESLDTLIRDLKSLPDISRKVNNLIPQDVLEYIEQGRNPDVYARQFSELVQKDNQYVNGKLYAIEGFQKAFAEEIKQAYPEVSSVVDKILNEGKVESTVS A780C526591714C3 med17_schpo Mediator of RNA polymerase II transcription subunit 17 med17 srb4 SPBC31F10.04c Mediator complex subunit 17 Suppressor of RNA polymerase B 4 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAEEANKDADISSLSLSLDPEIIGGQNNFLENNLQQIFQKIIQERGPFRDLKEEDLQKELQKESIKDESSAKSSETENVLEFATLDSKRNVNDTEVESMDSQAYKKELIEQIMIAQTECSLALDMTSLLLSKFKENSIETISPFLKSTVPPSSLQFSRSQPPESKESDATLAKCWKEKSLTSSCKFLFEAKERLTSVVETEHEYYTELVKVKEASWPLFNSQGSNHLSVQYSCLGGISLGLGLIRMKPESKSFEVQSSLLYSQAALKISILNKDRDEIGSSTWSWPSQNCNSVLLKDIYKLQEILFEMDIWNSLLQEAQSCGNQGVNFTGDEILVPISDDHVVRITLETSSKNTESGFTEDKKSNEDTSTNFVTIKQEKELLKCLCDTLNAIAHILFLKHCRKSDRRSQQPELYMAIDANAPLILRPLIFYYNLNQESLEFQRWLKQRDISFKFMPNYPWEKAKDFLELENSLSINRLSISWRIMVSNFEPAIFIQHTPTLHGTDKSVWRCKDQYSSNQFSSLKNVCQYIEHHINSLSRRSKKTE 5BC16074D9D0A05B 5BC16074D9D0A05B med4_schpo Mediator of RNA polymerase II transcription subunit 4 med4 pmc4 SPBC1105.06 Mediator complex subunit 4 RNA polymerase II mediator complex protein pmc4 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEYQRAIDSIEECLNKQLRLSSEKVDQYVLIENWTSLVGHLKTLHSLISNYTNGRELQNEISSLLKQDKELDLQIQDCMREMTSIYDTHLPKTVSGRKRQKVNAETLLDYGRKLSKFSSAPPGYNPETGQDAKAPVHYPWPSEDQMRKTLLFQFSTSMVPNLSATASQLFSEQPPKTNEPTETETEIDANKAVEEKTKMNYPASPTFTTQEENKEVESPANKDVFAGFDLFDPEMEEDF AE026602067F0DB3 med31_schpo Mediator of RNA polymerase II transcription subunit 31 med31 sep10 SPCP31B10.03c Mediator complex subunit 31 Cell separation protein sep10 Soh1 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast METKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE ACC93D4694A195F5 med11_schpo Mediator of RNA polymerase II transcription subunit 11 med11 Mediator complex subunit 11 SPAC644.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTNSDDDLFSEKSTSSDTQQVQNILELEAKIPDILSSAGKCIEAIQLNNSLEDFRKYSKEFLETVEFISTGLRRQALELEKAEVPVVSLQPKKRYASTPLSNLIFDQSSKLM 8D2077ECDFE8E3DD med21_schpo Mediator of RNA polymerase II transcription subunit 21 med21 srb7 SPBC1604.10 Mediator complex subunit 21 Suppressor of RNA polymerase B 7 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MACRCTQLQDTIDEVATQFYSSIHYLSSHHDFVPLPGQEKVSDSKVNPISAEELQFAQRDLAKDLVTKFMQIDTLINQLPGISTAPKHQLEKIKKLQNSIEEKQLERKSLESENEDLKLQLAKRIETFGRLSCVLFQP 5A7C236108C09AF9 med6_schpo Mediator of RNA polymerase II transcription subunit 6 med6 pmc5 SPAC1002.15c Mediator complex subunit 6 RNA polymerase II mediator complex protein pmc5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASGAPPSVDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIEKFPQYNPQEGYTYPKLSNDNLEVDHSNTNEPADENKNQSIENADYSFSPEDFSVVRAFMQSLHSSKEAPDVK 84AE0C11F607F35A 84AE0C11F607F35A ye44_schpo Uncharacterized protein C24C9.04 SPAC24C9.04 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDPAHHIKDTSAELLSQQDFSILQSRLLEFLASQEARETVTASKELTLLRQGIRQLKEKVSKMEPEEMTVKEKKSIIEILKARIALKKAFLKMALSESNDTVVKKEDVRESPVDTFMENAT 28C3339DD8E0E807 med22_schpo Mediator of RNA polymerase II transcription subunit 22 med22 srb6 SPAC29A4.07 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT 52EA5A74C06C9FE1 52EA5A74C06C9FE1 med18_schpo Mediator of RNA polymerase II transcription subunit 18 med18 pmc6 sep11 SPAC5D6.05 Mediator complex subunit 18 Cell separation protein sep11 RNA polymerase II mediator complex protein pmc6 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQELYLLGVVPSRRFEAVVNSLSKTLDGPKTILEFWVVYRPKDVPPNLPRQPDSWLRLCSNIESHDETDTEWSKNTQWSMYLEGNSEPKREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEYIIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFHPMNEEQPWILHVYTHVADASNQVAMAKAEANLTKVKTLLSAFCDLKNVRL A3A3B518E3D85A62 A3A3B518E3D85A62 med19_schpo Mediator of RNA polymerase II transcription subunit 19 med19 rox3 SPCC1450.05c Mediator complex subunit 19 RNA polymerase II mediator complex protein rox3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAQAPEYHYVGSVDYQPTRPSAHQNLIELYGLTELAKKVGRVDEFGNKRKMRRSYKAYIQDLPGYNEILRDNTIKQWLTNPIREEVPIDIEFLHHVFSVEPGIIPGFNPKVFGLEDDVVMGNVSRDSSQPRSPSRRKK 32D1261667B27D52 med14_schpo Mediator of RNA polymerase II transcription subunit 14 Mediator complex subunit 14 Mediator of RNA polymerase II complex subunit pmc1 med14 pmc1 SPBC1A4.10c SPBP23A10.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEPPAIPHITEGFYPLPEIVETFSHHVLQELVSLAEVLPSMSNVEKKKKILDWLLRSRAFTMRLLVLARWVHLSPSVHRCIDVVAFLQGQKFCFQNLVHVLQDIRYQLSFARLRNSDLVTALDILSTGTSLRLANAPTSKLYMLSESPLSTKQILQTLHALNMLIRIRLSLYEIIPTPFQHFTIANGRCTFTVPNEFSVSLTTNSQDPKSTGISFQWIVVDFQFHLPDFSSTPAKYRVFIELHLNEEIAAAFVLQKPILPLIYNILHKFCLYQRLNLLSQQTFQLSRESWLGHLRGVYDEKPPRLRLYYWPQLNVKKEGKPGKIGHYIHIFVNTQPISAFERTLSSKRSSCEYDHFLLLVEWHHDGIVEHVPLDDHMDAQHLLLLITQKHAQLILEQIRKELHPNIFSEHVGGGLKIHVFDNEIIVKVNSVTGRLVLSSSASPLSPPRHLRAAEKNIALNTQPPAQILNRLYFFCIQTQLLEVAQCAELHAVQGYYSFPYLTFSKGKWRKDGDSLWVLAYNVESNSWSVRLLNAAGQTLYTQDVHTTKGTLSIESFSRLSYLLEVQILLFNVQTACQARGMPFEYLPIPPKALIEDDFTTYVQTGCLCIMMPSSNEDMLPVVFVRAHDGQLIFDSRIKGKLPYQSETETEKNCYIDWRTGRITIRVQNFSSFEKTWIGLLKLVALSKTSAFNVDCITLKHVDFTYLDDEKFRATIHDDNTFTLHFFNRHSPFHLISQFLQDTFSDGPSAIQPLRVIMDRTRGVLVAQELGYVVLARSLRQYRIILSKNHGIQVLLNRHGCILQDLSYLSADSRYLEGTQTLTSQWEPCSWLNTVWEGDLGDDELNGQIEAAPEMHLIKMNKTADLTAILKRILAISRKK C6449D586FB613E8 med10-med11-1 2 14 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig 1, Extended Data Table 1 med10-med11-2 1 14 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig 1