DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m7GDP and its Edc3 activator. Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m7GDP and its Edc3 activator. Nature structural & molecular biology 2016 imex curation Charenton C., Taverniti V., Gaudon-Plesse C., Back R., Séraphin B., Graille M. marc.graille@polytechnique.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Charenton C., Taverniti V., Gaudon-Plesse C., Back R., Séraphin B., Graille M. marc.graille@polytechnique.edu Accepted 2020-MAR-24 AT 05:16 GMT AT 05:16 GMT by KALPANAP Nature structural & molecular biology 2016 Only protein-protein interactions imex curation imex curation Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m7GDP and its Edc3 activator. Structure of the active form of Dcp1-Dcp2 decapping enzyme bound to m7GDP and its Edc3 activator. Nature structural & molecular biology 2016 imex curation Charenton C., Taverniti V., Gaudon-Plesse C., Back R., Séraphin B., Graille M. marc.graille@polytechnique.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Charenton C., Taverniti V., Gaudon-Plesse C., Back R., Séraphin B., Graille M. marc.graille@polytechnique.edu Accepted 2020-MAR-24 AT 05:16 GMT AT 05:16 GMT by KALPANAP Nature structural & molecular biology 2016 Only protein-protein interactions imex curation imex curation q6ciu1_klula KLLA0_F23980g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSLPLLRPFETVSLENAVEDLVVRFILNVPPEDLSTVERVLFHFEEASWFYTDFVKLMNPYLPNLSIKSFSKIVIDICPLIWNWDITPENALVKFSNYKKTIPVRGAAIFNDSLSKILLLRGINSKHWSFPRGKIGKDEDDVACCIREVKEETGFDLTGFIDADQYVERNMNGKNFKIFLVKGVPEDFEFKPEHKNEIQAIEWKDFKKLSKAITKNEGSAKVFLVNSMIRPLSLYVKNEKRAKDENKLKLYAEEHLKSILGLNKKENKIVLDAGRELMEMLQKSAKTAQHQARNETYVAENPVVDVNQARSLFPLMSVQSVSHFSSSNNTNNNIVNGTGMTINTTGNNKLDHEKSYSTEQNTDLQASSKELLAFLHKSSTVNDKERQISGSDSVSSFPSAHFTEFTDDENYEEFESSSDESQYESSQEQLGHSDTEWDPNRDDELLTVKEPKSVKETQPSKPVKPETKQGATNNQKPILLKRPESQNKANNIESQTVKPKIRLLRRGDTLASATQSPSNESIKAVSEKRNDTETTSNKNAANDLLSILKKPSEDQPKINDSETHSNRSVANDLLSILKKPSRSEVPGAASSPLFTNTFENSQSSSSNASVEHHTSSNNDRNGSNFSKQFTASPALNEPSPKNDASDLMQLLKRPQQNSEPQSPISDLSPASKPSNELLNILKNPKTGLNSQISDDPVTHNTQYNRMPPLQVQPQQPFQMQQMQQMMPPPGYPPQNMSYIPQGFSPQQQFQYQQPINGYPMQPQPLNMGQPAPNQGFTKQQELLNILHKPNAPVQETPSNPSSELLSILKR F17E6D17FAE80ED0 q6cx48_klula Enhancer of mRNA-decapping protein 3 KLLA0_A11308g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MLNFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQDGGVSPVFKIKADKLYDLKVLKLPPNANVKMNNGNGNGNGNGKQEKEKEKGKERDRFTEKADEIWDTEMSSDFDFQGNLQRFNKKDAFKDFQNVEIPKDETKIPHNEMVTAGNVKETTSDSDKITESINITHLLRNDSIAASLANQRKTFTCGSKNKIKVPLATPIQLLEMEKIADEKFMLPLKTSLEHSGIHISRLLRNMLKSYTPPATSDSDAVPTVVAFVSGGRSGSRCISALRCLLYIKDIRCIIVNPFINERESFDDDISTEQINKIKTLNNVHFPDSLAKLKELLQNEPPSIIIDALQGFDDTVSDLDFSPDSNDNIAQYIKWINSHETVSACLEVISFDCPAHIDPSSGDVIESDFVHPTTILSTGWPLHCLPKLTQILPDWRNTYVYDTGVPQQTYLLKPNLRKFYKLDIYPGFSGTQELK 7B7C355FDC998073 q6cpv9_klula KLLA0_E01827g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSTETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDNWNKLEYQGVLAIYLRDVGDKEAILPEVSSYDDTITGQQSEANTPHVLTGHDIYNYGLIIMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGIWVHTPEDRQNIYELIKYLLENEPTDSFT 36DFE2D3C316ACA6 q6ciu1_klula-q6cpv9_klula-1 2 4 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified native native ecoli Escherichia coli (strain K12) 3 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 1, Table 1, Supplementary Fig 2 q6ciu1_klula-q6cpv9_klula-2 2 5 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified native native ecoli Escherichia coli (strain K12) 3 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1, Table 1, Supplementary Fig 2 q6ciu1_klula-q6cpv9_klula-3 1 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified native native binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified native native ecoli Escherichia coli (strain K12) 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified native native HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sufficient to bind sufficient to bind sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supplementary Fig 1