MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Neisserial Opa Protein-CEACAM Interactions: Competition for Receptors as a Means of Bacterial Invasion and Pathogenesis. Neisserial Opa Protein-CEACAM Interactions: Competition for Receptors as a Means of Bacterial Invasion and Pathogenesis. Biochemistry 2016 imex curation Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L., Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L. columbus@virgina.edu 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L., Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L. Fluorescently labeled NCCM1 H139C and NCCM3 H139C were incubated with varying concentrations of Opa60 or OpaD proteoliposomes or liposomes without protein, and the fluorescence polarization was measured. columbus@virgina.edu Accepted 2020-DEC-01 AT 11:31 GMT AT 11:31 GMT by LUANA Biochemistry 2016 Only protein-protein interactions imex curation imex curation Neisserial Opa Protein-CEACAM Interactions: Competition for Receptors as a Means of Bacterial Invasion and Pathogenesis. Neisserial Opa Protein-CEACAM Interactions: Competition for Receptors as a Means of Bacterial Invasion and Pathogenesis. Biochemistry 2016 imex curation Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L., Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L. columbus@virgina.edu 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L., Martin JN., Ball LM., Solomon TL., Dewald AH., Criss AK., Columbus L. columbus@virgina.edu Accepted 2020-DEC-01 AT 11:31 GMT AT 11:31 GMT by LUANA Biochemistry 2016 Only protein-protein interactions imex curation imex curation opah_neigo Opacity protein opA60 opaH protein protein neigo Neisseria gonorrhoeae ASEDGGRGPYVQADLAYAYEHITHDYPEPTAPNKNKISTVSDYFRNIRTRSVHPRVSVGYDFGGWRIAADYARYRKWNNNKYSVNIENVRIRKENGIRIDRKTENQENGTFHAVSSLGLSAIYDFQINDKFKPYIGARVAYGHVRHSIDSTKKTIEVTTVPSNAPNGAVTTYNTDPKTQNDYQSNSIRRVGLGVIAGVGFDITPKLTLDAGYRYHNWGRLENTRFKTHEASLGVRYRF 883A3560C2DF1B9F ceam3_human Carcinoembryonic antigen-related cell adhesion molecule 3 CEACAM3 CD66D CGM1 Carcinoembryonic antigen CGM1 protein protein human Homo sapiens Human MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS 179F0C51C6A062A1 opad_neigo Opacity protein opA59 opaD protein protein neigo Neisseria gonorrhoeae AGEDHGRGPYVQADLAYAYEHITHDYPEPTGTKKDKISTVSDYFRNIRTHSIHPRVSVGYDFGGWRIAADYARYRKWNNNKYSVNIKELLRNDNANSGGSHLNIKTRKTEHRENGTFHAASSLGLSAVYDFDTGSRFKPYIGMRVAYGHVRHQVRSVQQETIAVTTYPQNAASSVTTNAPIRKLPHHESRSISSLGFGAVAGVGIDITPNLTLDAGYRYHNWGRLENTRFKTHEASLGVRYRF 5930C73917436041 ceam1_human Carcinoembryonic antigen-related cell adhesion molecule 1 CEACAM1 BGP BGP1 Biliary glycoprotein 1 protein protein human Homo sapiens Human MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ DIP protein P13688 original sequence version: 164 CAD1B2328D069AF8 ceacam1-opah-1 2 6 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey purified purified ecolx Escherichia coli direct interaction direct interaction fig. 3a To determine if Opa proteins retain their ability to interact with receptors in vitro, pull-down assays were performed with Opa proteins reconstituted into small unilamellar liposomes (less than 100 nm). Opa60 and OpaD proteoliposome pellets contained both NCCM1 and 3, indicating that these Opa proteins retain their ability to interact with both NCCM1 and 3 when recombinantly expressed and reconstituted into liposomes. For NCCM1, weaker bands are observed for Opa50 and OpaTrp compared to Opa60 and OpaD, indicating that there is some non-specific interaction of NCCM1 with the liposomes. For NCCM3, a band is also observed in the pellet with both OpaTrp and Opa50, indicating non-specific interactions are occurring. ceacam1-opad-1 2 6 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey purified purified ecolx Escherichia coli direct interaction direct interaction fig. 3a To determine if Opa proteins retain their ability to interact with receptors in vitro, pull-down assays were performed with Opa proteins reconstituted into small unilamellar liposomes (less than 100 nm). Opa60 and OpaD proteoliposome pellets contained both NCCM1 and 3, indicating that these Opa proteins retain their ability to interact with both NCCM1 and 3 when recombinantly expressed and reconstituted into liposomes. For NCCM1, weaker bands are observed for Opa50 and OpaTrp compared to Opa60 and OpaD, indicating that there is some non-specific interaction of NCCM1 with the liposomes. For NCCM3, a band is also observed in the pellet with both OpaTrp and Opa50, indicating non-specific interactions are occurring. ceacam3-opah-1 2 4 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey purified purified ecolx Escherichia coli direct interaction direct interaction fig. 3b To determine if Opa proteins retain their ability to interact with receptors in vitro, pull-down assays were performed with Opa proteins reconstituted into small unilamellar liposomes (less than 100 nm). Opa60 and OpaD proteoliposome pellets contained both NCCM1 and 3, indicating that these Opa proteins retain their ability to interact with both NCCM1 and 3 when recombinantly expressed and reconstituted into liposomes. For NCCM1, weaker bands are observed for Opa50 and OpaTrp compared to Opa60 and OpaD, indicating that there is some non-specific interaction of NCCM1 with the liposomes. For NCCM3, a band is also observed in the pellet with both OpaTrp and Opa50, indicating non-specific interactions are occurring. ceacam1-opad-2 2 4 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey purified purified ecolx Escherichia coli direct interaction direct interaction fig. 3b To determine if Opa proteins retain their ability to interact with receptors in vitro, pull-down assays were performed with Opa proteins reconstituted into small unilamellar liposomes (less than 100 nm). Opa60 and OpaD proteoliposome pellets contained both NCCM1 and 3, indicating that these Opa proteins retain their ability to interact with both NCCM1 and 3 when recombinantly expressed and reconstituted into liposomes. For NCCM1, weaker bands are observed for Opa50 and OpaTrp compared to Opa60 and OpaD, indicating that there is some non-specific interaction of NCCM1 with the liposomes. For NCCM3, a band is also observed in the pellet with both OpaTrp and Opa50, indicating non-specific interactions are occurring. ceacam1-opah-2 1 3 unspecified role unspecified role neutral component neutral component purified purified ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component purified purified P13688:p.His139Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Sun Dec 13 18:44:23 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P13688:p.his139cys' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fig 4a ceacam1-opah-3 1 5 unspecified role unspecified role neutral component neutral component purified purified ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component purified purified P13688:p.His139Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Sun Dec 13 19:43:36 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P13688:p.his139cys' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fig 4b ceacam3-opah-2 1 3 unspecified role unspecified role neutral component neutral component purified purified ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component purified purified P40198:p.His139Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Sun Dec 13 19:37:35 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P13688:p.his139cys' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fig 4c ceacam3-opah-3 1 5 unspecified role unspecified role neutral component neutral component purified purified ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component purified purified P40198:p.His139Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Sun Dec 13 19:50:37 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P13688:p.his139cys' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fig 4d ceacam1-opah-4 1 6 competitor competitor competitor neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role neutral component neutral component purified purified ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component purified purified P13688:p.His139Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Sun Dec 13 20:04:22 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P13688:p.his139cys' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association suppl fig 9a ceacam3-opah-4 1 4 competitor competitor competitor neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role neutral component neutral component purified purified ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component purified purified P40198:p.His139Cys mutation mutation certain certain sequence position certain certain certain sequence position certain H C Sun Dec 13 19:07:06 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P13688:p.his139cys' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction suppl fig 9b