UniProt UniProt http://www.uniprot.org Expression of TMEM207 in Colorectal Cancer: Relation between TMEM207 and Intelectin-1. Expression of TMEM207 in Colorectal Cancer: Relation between TMEM207 and Intelectin-1. Journal of Cancer 2015 imex curation Maeda K., Saigo C., Kito Y., Sakuratani T., Yoshida K., Takeuchi T. takeutit08@gmail.com 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-rcm1 Human rectum adenocarcinoma RCM-1 cells rcm1 Human rectum adenocarcinoma RCM-1 cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maeda K., Saigo C., Kito Y., Sakuratani T., Yoshida K., Takeuchi T. takeutit08@gmail.com Accepted 2020-NOV-26 AT 14:14 GMT AT 14:14 GMT by MGT Journal of Cancer 2015 Only protein-protein interactions imex curation imex curation Expression of TMEM207 in Colorectal Cancer: Relation between TMEM207 and Intelectin-1. Expression of TMEM207 in Colorectal Cancer: Relation between TMEM207 and Intelectin-1. Journal of Cancer 2015 imex curation Maeda K., Saigo C., Kito Y., Sakuratani T., Yoshida K., Takeuchi T. takeutit08@gmail.com 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-colon_cancer human colonic cancer tissue Human colon_cancer Colon cancer tisuue pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Maeda K., Saigo C., Kito Y., Sakuratani T., Yoshida K., Takeuchi T. takeutit08@gmail.com Accepted 2020-NOV-26 AT 14:14 GMT AT 14:14 GMT by MGT Journal of Cancer 2015 Only protein-protein interactions imex curation imex curation tm207_human Transmembrane protein 207 TMEM207 UNQ846/PRO1784 protein protein human Homo sapiens Human MSRSRLFSVTSAISTIGILCLPLFQLVLSDLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQCWLRRPRIDSHRRTMAVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT 1FAB4346037B6DAE itln1_human Intelectin-1 ITLN1 INTL ITLN LFR Endothelial lectin HL-1 Galactofuranose-binding lectin Intestinal lactoferrin receptor Omentin UNQ640/PRO1270 protein protein human Homo sapiens Human MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR DIP protein Q8WWA0 original sequence version: 108 itln1-tmem207-1 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3A tmem207-itln1-1 2 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3B