UniProt UniProt http://www.uniprot.org Validation of FRET Assay for the Screening of Growth Inhibitors of Escherichia coli Reveals Elongasome Assembly Dynamics. Validation of FRET Assay for the Screening of Growth Inhibitors of Escherichia coli Reveals Elongasome Assembly Dynamics. International journal of molecular sciences 2014 imex curation van der Ploeg R., Goudelis ST., den Blaauwen T. t.denblaauwen@uva.nl 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence van der Ploeg R., Goudelis ST., den Blaauwen T. t.denblaauwen@uva.nl Accepted 2020-OCT-12 AT 11:40 BST AT 11:40 BST by MGT International journal of molecular sciences 2014 Only protein-protein interactions imex curation imex curation rodz_ecoli Cytoskeleton protein RodZ rodZ b2516 JW2500 yfgA protein protein ecoli Escherichia coli (strain K12) MNTEATHDQNEALTTGARLRNAREQLGLSQQAVAERLCLKVSTVRDIEEDKAPADLASTFLRGYIRSYARLVHIPEEELLPGLEKQAPLRAAKVAPMQSFSLGKRRKKRDGWLMTFTWLVLFVVIGLSGAWWWQDRKAQQEEITTMADQSSAELSSNSEQGQSVPLNTSTTTDPATTSTPPASVDTTATNTQTPAVTAPAPAVDPQQNAVVSPSQANVDTAATPAPTAATTPDGAAPLPTDQAGVTTPVADPNALVMNFTADCWLEVTDATGKKLFSGMQRKDGNLNLTGQAPYKLKIGAPAAVQIQYQGKPVDLSRFIRTNQVARLTLNAEQSPAQ DIP protein P27434 original sequence version: 81 67F90B10319F61C0 mrda_ecoli Peptidoglycan D,D-transpeptidase MrdA mrdA pbpA b0635 JW0630 Penicillin-binding protein 2 protein protein ecoli Escherichia coli (strain K12) MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDALRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVSKINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTGGVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKVPHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAMILENGGAGPAVGTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH FE2305C002743AF6 mreb_ecoli Cell shape-determining protein MreB mreB envB rodY b3251 JW3220 Actin-like MreB protein Rod shape-determining protein MreB protein protein ecoli Escherichia coli (strain K12) MLKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFMRPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEIGSAYPGDEVREIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE 1393696D8CDAEF93 1393696D8CDAEF93 roda_ecoli Peptidoglycan glycosyltransferase MrdB mrdB rodA b0634 JW0629 Cell elongation protein RodA Cell wall polymerase Peptidoglycan polymerase Rod shape-determining protein protein protein ecoli Escherichia coli (strain K12) MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGMMERKIGQIAMGLVIMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLDLGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTSILVALSGLFVLFLSGLSWRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIHTHRKMLSKSV This sequence has been withdrawn from Uniprot. 68FCDF8D6B123D69 68FCDF8D6B123D69 mreb-mreb-2 1 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig 4, Supp Table 2 S-(3,4-Dichlorobenzyl) Isothiourea Mecillinam (CHEBI:51208) mrdb-mrda-1 1 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed n-terminal mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 4, Supp Table 2 S-(3,4-Dichlorobenzyl) Isothiourea Mecillinam (CHEBI:51208) rodz-mreb-1 1 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 4,Supp. Table 2 S-(3,4-Dichlorobenzyl) Isothiourea Mecillinam (CHEBI:51208) mrda-mreb-1 1 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 4, Supp. Table 2 S-(3,4-Dichlorobenzyl) Isothiourea Mecillinam (CHEBI:51208) mrda-mreb-2 1 3 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminal, Kusabira Orange fluorescent prot tag fluorescent protein tag fluorescent prot tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed n-terminal mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Supp. Table 1 rodz-mrda-1 1 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed n-terminal mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 4,Supp. Table 2 S-(3,4-Dichlorobenzyl) Isothiourea Mecillinam (CHEBI:51208)