IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. Nature communications 2013 imex curation Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Association between fluorescently tagged PKA subunits was studied in living cells, measured by FRET davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de Accepted 2020-JUL-31 AT 07:47 BST AT 07:47 BST by PPORRAS Nature communications 2013 Only protein-protein interactions imex curation imex curation PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. Nature communications 2013 imex curation Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de Accepted 2020-JUL-31 AT 07:47 BST AT 07:47 BST by PPORRAS Nature communications 2013 Only protein-protein interactions imex curation imex curation PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. Nature communications 2013 imex curation Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de Accepted 2020-JUL-31 AT 07:47 BST AT 07:47 BST by PPORRAS Nature communications 2013 Only protein-protein interactions imex curation imex curation PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit. Nature communications 2013 imex curation Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Calebiro D., Hannawacker A., Lyga S., Bathon K., Zabel U., Ronchi C., Beuschlein F., Reincke M., Lorenz K., Allolio B., Kisker C., Fassnacht M., Lohse MJ. Rare diseases - Interactions investigated in the context of Rare genetic disease davide.calebiro@toxi.uni-wuerzburg.de,lohse@toxi.uni-wuerzburg.de Accepted 2020-JUL-31 AT 07:47 BST AT 07:47 BST by PPORRAS Nature communications 2013 Only protein-protein interactions imex curation imex curation kap0_human cAMP-dependent protein kinase type I-alpha regulatory subunit Tissue-specific extinguisher 1 PRKAR1A PKR1 PRKAR1 TSE1 protein protein human Homo sapiens Human MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV DIP protein P10644 original sequence version: 173 DIP protein P10644 original sequence version: 127 DIP protein P10644 original sequence version: 134 DIP protein P10644 original sequence version: 179 2D04F08CE8857A6D kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF DIP protein P17612 original sequence version: 171 DIP protein P17612 original sequence version: 175 DIP protein P17612 original sequence version: 178 DIP protein P17612-1 original sequence version: 177 DIP protein P17612 original sequence version: 186 DIP protein P17612 original sequence version: 102 DIP protein P17612-1 original sequence version: 102 BF6D3ECD2614E5AB kap3_human cAMP-dependent protein kinase type II-beta regulatory subunit PRKAR2B protein protein human Homo sapiens Human MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA DIP protein P31323 original sequence version: 143 83F402CCFFEFD186 prkaca-prkar2b-3 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P17612:p.Leu206Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R Tue Jun 30 16:12:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu206Arg' P17612:p.Leu199_Cys200insTrp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LC LWC Tue Jun 30 19:44:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu199_Cys200insTrp' 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2 prkar2b-prkaca-6 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P17612:p.Leu206Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R Tue Jun 30 17:53:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu206Arg' P17612:p.Leu199_Cys200insTrp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LC LWC Tue Jun 30 17:20:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu199_Cys200insTrp' 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3a The column was eluted with stepwise increasing concentrations of cAMP. The mutants had very weak interaction with PKA RII beta subunit prkar2b-prkaca-7 4 5 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed cell lysate cell lysate region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed cell lysate cell lysate region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17612:p.Leu206Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R Tue Jun 30 18:07:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu206Arg' P17612:p.Leu199_Cys200insTrp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LC LWC Tue Jun 30 19:41:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu199_Cys200insTrp' proximity proximity close-contact colocalization neighbourhood interaction Fig. 4e cAMP (CHEBI:17489) prkar2b-prkaca-8 4 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed cell lysate cell lysate region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17612:p.Leu206Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L R Tue Jun 30 16:48:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu206Arg' P17612:p.Leu199_Cys200insTrp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LC LWC Tue Jun 30 17:56:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu199_Cys200insTrp' 7 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed cell lysate cell lysate region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Fig. 4b-d cAMP (CHEBI:17489) prkar2b-prkaca-10 1 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17612:p.Leu206Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R Tue Jun 30 16:48:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu206Arg' P17612:p.Leu199_Cys200insTrp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain LC LWC Tue Jun 30 17:56:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu199_Cys200insTrp' 7 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Fig. 6 cAMP (CHEBI:17489)