UniProt UniProt http://www.uniprot.org Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation. Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation. Proceedings of the National Academy of Sciences of the United States of America 2013 imex curation Chang J., Lee S., Blackstone C. Source of proteins and details of the constructs taken from referenced in the text, primarily PMID: 20200447 blackstc@ninds.nih.gov Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chang J., Lee S., Blackstone C. Source of proteins and details of the constructs taken from referenced in the text, primarily PMID: 20200447 blackstc@ninds.nih.gov Accepted 2020-JUN-24 AT 08:18 BST AT 08:18 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation. Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation. Proceedings of the National Academy of Sciences of the United States of America 2013 imex curation Chang J., Lee S., Blackstone C. Source of proteins and details of the constructs taken from referenced in the text, primarily PMID: 20200447 blackstc@ninds.nih.gov Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chang J., Lee S., Blackstone C. Source of proteins and details of the constructs taken from referenced in the text, primarily PMID: 20200447 blackstc@ninds.nih.gov Accepted 2020-JUN-24 AT 08:18 BST AT 08:18 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation. Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation. Proceedings of the National Academy of Sciences of the United States of America 2013 imex curation Chang J., Lee S., Blackstone C. Source of proteins and details of the constructs taken from referenced in the text, primarily PMID: 20200447 blackstc@ninds.nih.gov Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Chang J., Lee S., Blackstone C. Source of proteins and details of the constructs taken from referenced in the text, primarily PMID: 20200447 blackstc@ninds.nih.gov Accepted 2020-JUN-24 AT 08:18 BST AT 08:18 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation reep5_human Receptor expression-enhancing protein 5 REEP5 C5orf18 DP1 TB2 Polyposis locus protein 1 Protein TB2 protein protein human Homo sapiens Human MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST F4E57E500CB7C831 atla1_human Atlastin-1 ATL1 GBP3 SPG3A Spastic paraplegia 3 protein A Guanine nucleotide-binding protein 3 GTP-binding protein 3 Brain-specific GTP-binding protein protein protein human Homo sapiens Human MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM DIP protein Q8WXF7 original sequence version: 118 DIP protein Q8WXF7 original sequence version: 95 68A33C39DD43504C spast_human Spastin SPAST KIAA1083 SPG4 ADPSP FSP2 Spastic paraplegia 4 protein protein protein human Homo sapiens Human MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESPHKRNLYYFSYPLFVGFALLRLVAFHLGLLFVWLCQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLEKMQPVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV DIP protein Q9UBP0 original sequence version: 139 75E5FC5787132B4C zfy27_human Protrudin Spastic paraplegia 33 protein SPG33 Zinc finger FYVE domain-containing protein 27 ZFYVE27 protein protein human Homo sapiens Human MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMPLCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRLSRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK reep1_human Receptor expression-enhancing protein 1 REEP1 C2orf23 SPG31 Spastic paraplegia 31 protein protein protein human Homo sapiens Human MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA 98F120DE100276A9 atla3_human Atlastin-3 ATL3 protein protein human Homo sapiens Human MLSPQRVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFELDEKALASILLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYSQKESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYSYGLQGGMAFLDKRLQVKEHQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDGKLKDIAGEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIVALYIASGLTGFIGLEVVAQLFNCMVGLLLIALLTWGYIRYSGQYRELGGAIDFGAAYVLEQASSHIGNSTQATVRDAVVGRPSMDKKAQ E5C58A53F93B42D0 atla2_human Atlastin-2 ATL2 ARL6IP2 ADP-ribosylation factor-like protein 6-interacting protein 2 protein protein human Homo sapiens Human MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD 885738C43996DEBF zfyve27-atl1-1 1 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2F zfyve27-zfyve27-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig. 1B zfyve27-zfyve27-2 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Figs. 1B-D We further examined protrudin oligomerization using two different epitope-tagged recombinant proteins. Lysates from cells coexpressing HA- and Myc-tagged protrudin were immunoprecipitated, and HA- and Myc-protrudin proteins coprecipitated with both Myc- and HA-epitope antibodies, confirming that protrudin can homooligomerize (Fig. S1B). reep5-zfyve27-1 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q5T4F4:p.Gly191Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G V Tue Jun 30 19:42:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly191Val' n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5T4F4:p.Pro200Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 16:38:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro200Ala' 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig 2A, Supp Figs. 2, 5F atl3-zfyve27-1 3 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig 2A zfyve27-reep1-1 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Fig. 3A reep1-zfyve27-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Figs. 3A, 3D reep5-zfyve27-2 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind range range certain certain sequence position certain n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Figs. 3B, 3E, 3F zfyve27-reep5-1 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Fig. 3B spast-zfyve27-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp Figs. 4D spast-zfyve27-2 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp Figs. 4C spast-zfyve27-3 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Supp Figs. 4B zfyve27-atl1-2 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig.5A atl1-zfyve27-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8WXF7:p.Gly469Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G A Tue Jun 30 18:15:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly469Ala' Q8WXF7:p.Arg495Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R W Tue Jun 30 15:44:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg495Trp' Q8WXF7:p.Lys80Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:14:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys80Ala' Q8WXF7:p.Ser519Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 16:53:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser519Ala' physical association physical association Supp Figs. 5B, 5D zfyve27-atl2-1 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Figs.5A zfyve27-atl3-1 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Figs.5A atl1-zfyve27-2 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5T4F4:p.Gly191Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G V Tue Jun 30 17:23:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly191Val' 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp Fig. 5G reep5-spast-1 3 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Supp Figs. 4B Recombinant M1 spastin was codistributed with endogenous REEP5 and recombinant HA-protrudin along ER tubules, whereas M87 spastin was dispersed throughout the cytoplasm. zfyve27-atl1-3 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp Fig 5C atl1-zfyve27-3 3 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5T4F4:p.Gly191Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G V Tue Jun 30 17:53:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly191Val' 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp Fig. 5E