IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. PloS one 2012 imex curation Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Figure S2 not curated as there is no identification of breakdown products. christine.gaboriaud@ibs.fr Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Interactions with trypsin (Sigma-Bovine Pancreas -TPCK treated), have not been curated as it is unclear which form of trypsin was used or if it was a mixture of proteins. Figure S2 not curated as there is no identification of breakdown products. Amidolytic activity using a fluorometric assay based on the measurement of AMC (aminomethylcoumarin) released upon cleavage. Activity was measured in units -pmol/min/ug enzyme. christine.gaboriaud@ibs.fr Accepted 2021-DEC-23 AT 06:56 GMT AT 06:56 GMT by KALPANAP PloS one 2012 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. PloS one 2012 imex curation Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Figure S2 not curated as there is no identification of breakdown products. christine.gaboriaud@ibs.fr Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column edman degradation edman degradation Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Figure S2 not curated as there is no identification of breakdown products. christine.gaboriaud@ibs.fr Accepted 2021-DEC-23 AT 06:56 GMT AT 06:56 GMT by KALPANAP PloS one 2012 Only protein-protein interactions imex curation imex curation The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. PloS one 2012 imex curation Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Figure S2 not curated as there is no identification of breakdown products. christine.gaboriaud@ibs.fr Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Figure S2 not curated as there is no identification of breakdown products. christine.gaboriaud@ibs.fr Accepted 2021-DEC-23 AT 06:56 GMT AT 06:56 GMT by KALPANAP PloS one 2012 Only protein-protein interactions imex curation imex curation The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. The serine protease domain of MASP-3: enzymatic properties and crystal structure in complex with ecotin. PloS one 2012 imex curation Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Figure S2 not curated as there is no identification of breakdown products. christine.gaboriaud@ibs.fr Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM., Gaboriaud C., Gupta RK., Martin L., Lacroix M., Serre L., Teillet F., Arlaud GJ., Rossi V., Thielens NM. Interactions with trypsin (Sigma-Bovine Pancreas -TPCK treated), have not been curated as it is unclear which form of trypsin was used or if it was a mixture of proteins. Figure S2 not curated as there is no identification of breakdown products. No information in references can be found for the construct "MASP-2 CCP1/2-ap-SP". This construct is probably the one referred to in Ref. 32 (pmid;11527969 ) as the "CCP1/2-SP construct". christine.gaboriaud@ibs.fr Accepted 2021-DEC-23 AT 06:56 GMT AT 06:56 GMT by KALPANAP PloS one 2012 Only protein-protein interactions imex curation imex curation thrb_human Prothrombin F2 Coagulation factor II protein protein human Homo sapiens Human MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE DIP protein P00734 original sequence version: 122 DIP protein P00734 original sequence version: 127 DIP protein P00734 original sequence version: 129 8A25E1DA88208FCF p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER 09B5297A6C14283A p03951-pro_0000027826 Coagulation factor XIa light chain F11 Plasma thromboplastin antecedent protein protein human Homo sapiens Human IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV 388 625 2B7C0CBE57FF358B ecot_ecoli Ecotin eco eti b2209 JW2197 protein protein ecoli Escherichia coli (strain K12) MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR E965383177B92ECD dpr peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DPR kgr peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) KGR fsr peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FSR masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint ED952085FA115E21 gly-gly-arg peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GGR pro-phe-arg peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PFR p03951-pro_0000027825 Coagulation factor XIa heavy chain F11 Plasma thromboplastin antecedent protein protein human Homo sapiens Human ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR 19 387 B6061E1438283783 fgr peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FGR fvr peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FVR val-pro-arg peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VPR apr peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) APR eco-masp1-1 4 9 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Table 4 fgr-masp1-2 1 17 enzyme target enzyme target substrate substrate neutral component neutral component region coumarin label coumarin label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined methylsulfonyl modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain phe1 d-phe D-phenylalanine (R)-2-amino-3-phenylpropanoic acid D-phenylalanine MOD_RES D-phenylalanine D-Phe certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1/2 Activity =18.2 pmol/min/ug MASP-3 SP domain Table 2 gives Vmax as 89 pmol /min/ug enzyme. [Table 1 gives a value of 18.2 -it is unclear why these values differ.] I think they are using incorrect units for Vmax - these should be 'concentration/time' - what they are giving here is "enzyme (specific) activity" - which is per amount of protein. f2-fgr-1 1 17 enzyme target enzyme target substrate substrate neutral component neutral component region coumarin label coumarin label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined methylsulfonyl modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain phe1 d-phe D-phenylalanine (R)-2-amino-3-phenylpropanoic acid D-phenylalanine MOD_RES D-phenylalanine D-Phe certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =1990 pmol/min/ug Thrombin masp1-pfr-1 1 15 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1 Activity =16.1 pmol/min/ug MASP-3 SP domain f2-pfr-1 1 15 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =23 pmol/min/ug Thrombin masp1-vpr-1 1 19 enzyme target enzyme target substrate substrate neutral component neutral component t-Butyloxycarbonyl modval modified L-valine residue ModVal certain certain sequence position certain certain certain sequence position certain C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1/2 Activity =12.8 pmol/min/ug MASP-3 SP domain Table 2 gives Vmax as 45 pmol /min/ug enzyme. [Table 1 gives a value of 12.8 -it is unclear why these values differ.] I think they are using incorrect units for Vmax - these should be 'concentration/time' - what they are giving here is "enzyme (specific) activity" - which is per amount of protein. f2-vpr-1 1 19 enzyme target enzyme target substrate substrate neutral component neutral component t-Butyloxycarbonyl modval modified L-valine residue ModVal certain certain sequence position certain certain certain sequence position certain C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =14720 pmol/min/ug Thrombin dpr-masp1-1 1 10 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1 Activity =6.7 pmol/min/ug MASP-3 SP domain The stated supplier of the DPR peptide (Peptanova) does not sell this product and no mention of it can be found elsewhere. It has been assumed the sequence is Asp-Pro-Arg. dpr-f2-1 1 10 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =92430 pmol/min/ug Thrombin The stated supplier of the DPR peptide (Peptanova) does not sell this product and no mention of it can be found elsewhere. It has been assumed the sequence is Asp-Pro-Arg. f2-fsr-1 1 12 enzyme target enzyme target substrate substrate neutral component neutral component t-Butyloxycarbonyl modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =450 pmol/min/ug Thrombin fsr-masp1-1 1 12 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range t-Butyloxycarbonyl modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1 Activity =4.4 pmol/min/ug MASP-3 SP domain ggr-masp1-1 1 14 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range Benzyloxycarbonyl modgly modified glycine residue ModGly certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1 Activity =4.1 pmol/min/ug MASP-3 SP domain f2-ggr-1 1 14 enzyme target enzyme target substrate substrate neutral component neutral component Benzyloxycarbonyl modgly modified glycine residue ModGly certain certain sequence position certain certain certain sequence position certain C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =230 pmol/min/ug Thrombin f2-kgr-1 1 11 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =246 pmol/min/ug Thrombin No details can be found for the peptide KGR; It has been assumed the sequence is Lys-Gly-Arg, but it is not known if the sequence has been modified or not. kgr-masp1-1 1 11 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1 Activity =3.8 pmol/min/ug MASP-3 SP domain No details can be found for the peptide KGR; It has been assumed the sequence is Lys-Gly-Arg, but it is not known if the sequence has been modified or not. f2-fvr-1 1 18 enzyme target enzyme target substrate substrate neutral component neutral component Benzoyl modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =983 pmol/min/ug Thrombin. fsr-masp1-2 1 18 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range Benzoyl modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. protein cleavage protein cleavage Table 1 Activity =0.93 pmol/min/ug MASP-3 SP domain apr-f2-1 1 20 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus coumarin label coumarin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Table 1 Activity =1290 pmol/min/ug Thrombin No details can be found for the peptide APR; It has been assumed the sequence is Ala-Pro-Arg, but it is not known if the sequence has been modified or not. eco-masp1-2 5 9 unspecified role unspecified role bait bait purified purified 7 unspecified role unspecified role prey prey purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 3, Table 3. eco-masp1-3 5 13 unspecified role unspecified role prey prey purified purified ccp1/2 +SP sufficient to bind sufficient binding region sufficient to bind range range range range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Figure 3, Table 3. eco-f11_human-1 5 9 unspecified role unspecified role bait bait purified purified 124 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction Figure 3, Table 3. eco-masp1-4 3 9 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified SP domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Figure 4 Peak one. I have not entered anything for Peak 2 and 3 as they have not shown there is any evidence for a 2:1 Ecotin/protein entity, nor the Ecotin dimer - especially as the M.Wt for the Ecotin dimer should be 36kDa, not the stated 32. f11_human FXI complex Coagulation factor XIa complex F11 dimer Coagulation factor F11 complex FXIa complex 8 enzyme enzyme F11 heavy chain binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role F11 light chain binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 130 132 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A serine-type endopeptidase complex of the intrinsic blood coagulation pathway (contact activation pathway). Cleaves Arg-|-Ala and Arg-|-Val bonds of factor IX (P00740) by limited proteolysis to form active factor IXa (CPX-4945) and contributes to factor VIIa-TF complex (CPX-2808) activation. Also binds platelet glycoprotein Ib:IX:V complex. The coagulation pathway is terminated when fibrinogen is cleaved to fibrin which in turn polymerizes to produce a clot. Its zymogen form is activated by limited proteolysis by factor XIIa (CPX-6209) and thrombin (CPX-6222) to form active factor XIa. Inhibited by antithrombin (SERPINC1, P01008). Heterodimer Factor XI deficiency [MONDO:0020587]: a coagulation disorder characterized by the partial or complete absence of factor XI activity in the blood. Unlike most coagulation factors, FXIa probably doesn't directly bind calcium. Accepted 2020-OCT-06 by LIVIAP