DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis. Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis. Proceedings of the National Academy of Sciences of the United States of America 2013 imex curation Bao R., Nair MK., Tang WK., Esser L., Sadhukhan A., Holland RL., Xia D., Schifferli DM. dmschiff@vet. upenn.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bao R., Nair MK., Tang WK., Esser L., Sadhukhan A., Holland RL., Xia D., Schifferli DM. dmschiff@vet. upenn.edu Accepted 2021-MAR-23 AT 19:39 GMT AT 19:39 GMT by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation galactose galactose Gal Galactose Galaktose galacto-hexose galactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphocholine phosphocholine Choline phosphate ChoP N-Trimethyl-2-aminoethylphosphonate O-Phosphocholine O-phosphocholine PHOSPHOCHOLINE Phosphocholine Phosphoryl-choline Phosphorylcholine Trimethyl(2-(phosphonooxy)ethyl)ammonium N,N,N-trimethyl-2-(phosphonooxy)ethanaminium small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) psaa_yerpe pH 6 antigen psaA Adhesin Antigen 4 YPO1303 YP_1289 y2882 protein protein yerpe Yersinia pestis MKMKCFAKNALAVTTLMIAACGMANASTVINSKDVSGEVTVKQGNTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVF galactose-psaa-1 1 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig S4 phosphocholine-psaa-1 1 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig S4