IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Specific interaction of hepatitis C virus glycoproteins with mannan binding lectin inhibits virus entry. Specific interaction of hepatitis C virus glycoproteins with mannan binding lectin inhibits virus entry. Protein & cell 2010 imex curation Brown KS., Keogh MJ., Owsianka AM., Adair R., Patel AH., Arnold JN., Ball JK., Sim RB., Tarr AW., Hickling TP. alex.tarr@nottingham.ac.uk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Brown KS., Keogh MJ., Owsianka AM., Adair R., Patel AH., Arnold JN., Ball JK., Sim RB., Tarr AW., Hickling TP. alex.tarr@nottingham.ac.uk Accepted 2021-APR-19 AT 10:53 BST AT 10:53 BST by LPERFETTO Protein & cell 2010 Only protein-protein interactions imex curation imex curation galactose galactose Gal Galactose Galaktose galacto-hexose galactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mannose mannose Man mannose manno-hexose mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetyl-beta-d-glucosamine N-acetyl-beta-D-glucosamine 2-Acetamido-2-deoxy-D-glucose 2-Acetylamino-2-deoxy-D-glucose Acetylglucosamine betaGlcNAc GlcNAc-beta N-Acetyl-beta-D-glucosamine N-acetyl-beta-D-glucosamine N-Acetyl-D-glucosamine N-acetylglucosamine 2-acetamido-2-deoxy-beta-D-glucopyranose 2-acetamido-2-deoxyhexopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mannan mannan Mannan mannans Mannoglycan mannan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) maltose Maltose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 p27958-pro_0000037570 Envelope glycoprotein E2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 9243E2103B6CCA2D p27958_pro_0000037570-mbl2-1 1 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line physical association physical association 1A EDTA (CHEBI:42191) Ca2+(CHEBI:29108) mannan-mbl2-2 1 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 5 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 1A p27958_pro_0000037570-mbl2-2 1 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line physical association physical association 1B, 3 EDTA (CHEBI:42191) Ca2+(CHEBI:29108) The HCV E1 protein was also present. A monoclonal antibody directed to a linear epitope in the E2 protein was used for capture. MBL bound to (E1)/E2 proteins derived from all the genotypes of HCV tested. Hepatitis C virus genotype 1a (isolate H77) is the only reference strain for HCV. I had a look to see how possible it was to enter interactions from other strains, and decided it was not. p27958_pro_0000037570-mbl2-3 1 4 competitor competitor competitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line physical association physical association 2, number 1 The HCV E1 protein was also present. A monoclonal antibody directed to a linear epitope in the E2 protein was used for capture. p27958_pro_0000037570-mbl2-4 1 6 competitor competitor competitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line physical association physical association 2, number 2 The HCV E1 protein was also present. A monoclonal antibody directed to a linear epitope in the E2 protein was used for capture. p27958_pro_0000037570-mbl2-5 1 3 competitor competitor competitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line physical association physical association 2, number 3 The HCV E1 protein was also present. A monoclonal antibody directed to a linear epitope in the E2 protein was used for capture. p27958_pro_0000037570-mbl2-6 1 2 competitor competitor competitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line physical association physical association 2, number 4 The HCV E1 protein was also present. A monoclonal antibody directed to a linear epitope in the E2 protein was used for capture.