IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column elisa enzyme linked immunosorbent assay ELISA ELISA elisa Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation human-plasma homo sapiens blood plasma plasma blood plasma molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column elisa enzyme linked immunosorbent assay ELISA ELISA elisa Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom experimental particp experimental participant identification experimental particp Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Only protein-protein interactions imex curation human-plasma homo sapiens blood plasma plasma blood plasma elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Hansen S., Selman L., Palaniyar N., Ziegler K., Brandt J., Kliem A., Jonasson M., Skjoedt MO., Nielsen O., Hartshorn K., Jørgensen TJ., Skjødt K., Skjødt K., Holmskov U. Results from Supplemental Figure 3 have not been curated as the species origin of MASP-3 is not stated. Results from Supplemental Figure 4 have not been curated as it is not stated wether BSA-mannose or mannan was used to coat plates. gave up on trying to find out which DNA was used for EMSA:Ref. 31 quotes several plasmids, so no idea which one(s) were used here. dear checker: Supp. figure 4 - mannan is a polymer of mannose, but you still might get different results using each one??? SHansen@health.sdu.dk Accepted 2022-JAN-13 AT 13:22 GMT AT 13:22 GMT by LUANA Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation col11_human Collectin-11 COLEC11 Collectin kidney protein 1 UNQ596/PRO1182 protein protein human Homo sapiens Human MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM A14A248CE41DB340 masp1_human Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN 5B37C7FB9F51FD1D mannose mannose Man mannose manno-hexose mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 d-glucose D-glucose D(+)-glucose D-(+)-glucose dextrose grape sugar Traubenzucker D-gluco-hexose D-glucose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetyl-d-mannosamine N-acetyl-D-mannosamine 2-Acetamido-2-deoxy-D-mannose ManNAc N-acetylmannosamine WURCS=2.0/1,1,0/[a1122h-1x_1-5_2*NCC/3=O]/1/ 2-acetamido-2-deoxy-D-mannopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetyl-d-glucoseamine N-acetyl-D-glucoseamine N-[(2S,3R,4S,5S,6R)-2,3,4,5-tetrahydroxy-6-(hydroxymethyl)oxan-2-yl]acetamide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) d-mannose D-mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) col11_mouse Collectin-11 Colec11 Collectin kidney protein 1 protein protein mouse Mus musculus Mouse MMMRDLALAGMLISLAFLSLLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDKENL DEC4715CDCDE8B8F methyl d-glucoside methyl D-glucoside 1-O-Methyl-D-glucopyranose methyl D-glucopyranoside small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q3sxb8-1 Collectin-11 Collectin kidney protein 1 Colec11 protein protein mouse Mus musculus Mouse MMMRDLALAGMLISLAFLSLLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDKENL DEC4715CDCDE8B8F albu_bovin Albumin ALB BSA protein protein bovin Bos taurus (Bovine) Bovine MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA 39167DFE768585D4 methyl alpha-d-mannoside methyl alpha-D-mannoside 1-O-Methyl-alpha-D-mannopyranoside alpha-Methyl mannopyranoside alpha-methyl-D-mannoside Methyl-alpha-D-mannoside methyl alpha-D-mannopyranoside small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) d-galactose D-galactose D-Gal D-galacto-hexose D-galactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) colec11-5 1 8 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 1 colec11-1 1 8 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 1 colec11-6 3 18 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction 1A mannose-colec11-1 6 9 fingerprinting peptide massfingerprinting fingerprinting experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-plasma homo sapiens blood plasma plasma blood plasma 8 fingerprinting peptide massfingerprinting fingerprinting sequence tag sequence tag identification sequence tag experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-plasma homo sapiens blood plasma plasma blood plasma 10 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) association association 4B colec11-masp1-1 7 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 5A masp1-colec11-2 7 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 5C colec11-7 4 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6 CL-11 in plasma eluted within two broad peaks. One peak corresponded to a molecular mass of >950 kDa and the other to a molecular mass of 440 kDa. colec11-colec11-1 2 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6 CL-11 in plasma eluted within two broad peaks. One peak corresponded to a molecular mass of >950 kDa and the other to a molecular mass of 440 kDa. alb-colec11-1 5 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 52 50 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose. alb-colec11-2 5 20 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 60 58 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by methyl alpha-D-mannoside. The carbohydrate stated to have been used was "alpha-Methyl-d-mannose", but as no such molecule can be found it has been assumed that "methyl alpha-D-mannoside" was the intended molecule. alb-colec11-3 5 15 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 66 68 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by d-Mannose. alb-colec11-4 5 13 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 74 76 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by n-acetyl-d-mannosamine. alb-colec11-5 5 12 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 82 84 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by d-glucose. alb-colec11-6 5 14 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 90 92 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by N-Acetyl-d-glucoseamine. alb-colec11-7 5 17 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 98 100 direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by alpha-Methyl-d-glucose. As the molecule "alpha-Methyl-d-glucose" cannot be traced it has assumed to be "methyl alpha-D-glucose". alb-colec11-8 5 21 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 16 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum direct interaction direct interaction Table 1 Binding of Murine CL-11, expressed in either 293 or CHO cells, binding to BSA-conjugated Mannose and inhibited by d-Galactose.