IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. Virology 2010 imex curation Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus L.Enjuanes@cnb.csic.es Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins UB1-AC range was captured from back referenced 18367524 L.Enjuanes@cnb.csic.es Accepted 2020-JUN-19 AT 11:05 BST AT 11:05 BST by PPORRAS Virology 2010 Only protein-protein interactions imex curation imex curation The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. Virology 2010 imex curation Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus L.Enjuanes@cnb.csic.es Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins L.Enjuanes@cnb.csic.es Accepted 2020-JUN-19 AT 11:05 BST AT 11:05 BST by PPORRAS Virology 2010 Only protein-protein interactions imex curation imex curation The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. Virology 2010 imex curation Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus L.Enjuanes@cnb.csic.es Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins L.Enjuanes@cnb.csic.es Accepted 2020-JUN-19 AT 11:05 BST AT 11:05 BST by PPORRAS Virology 2010 Only protein-protein interactions imex curation imex curation The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. The envelope protein of severe acute respiratory syndrome coronavirus interacts with the non-structural protein 3 and is ubiquitinated. Virology 2010 imex curation Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus L.Enjuanes@cnb.csic.es Only protein-protein interactions imex curation in vitro In vitro tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Alvarez E., DeDiego ML., Nieto-Torres JL., Jiménez-Guardeño JM., Marcos-Villar L., Enjuanes L. Virus - Publications including interactions involving viral proteins Additional host proteins were also detected as preys but have not been added due to lack of suitable identifiers or sequences African green monkey proteins corresponding to the given human accessions gi | 34555776 (Dynein), gi | 41584442 (Fatty acid synthase), gi | 15451907 (Aminopeptidase puromycin sensitive), gi | 119606901 (Phosphofructokinase), gi | 14389309 (Alpha tubulin), gi | 18088719 (Beta tubulin), gi | 4501885 (Beta actin), gi | 13236587 (Transmembrane protein 43), gi | 62897717 (Lactate dehydrogenase A) were also found to be interacting with SARS CoV E; however, these proteins were not captured as their UniProt accession or sequences were not available at the time of curation L.Enjuanes@cnb.csic.es Accepted 2020-JUN-19 AT 11:05 BST AT 11:05 BST by PPORRAS Virology 2010 Only protein-protein interactions imex curation imex curation p0c6x7-pro_0000037311 Papain-like protease nsp3 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGG 819 2740 BBB1A6190358ADDE vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV A6D9A31652DDA194 vme1_sars Membrane protein M E1 glycoprotein Matrix glycoprotein Membrane glycoprotein 5 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ 275C37085A0215A8 spike_sars Spike glycoprotein S E2 Peplomer protein 2 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT DIP protein P59594 original sequence version: 48 e-rep-5 4 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] 5 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] 6 unspecified role unspecified role bait bait purified purified c-terminal flag-ha tandem tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 4a, Table 1 e-rep-6 2 5 unspecified role unspecified role bait bait infection infection 6 unspecified role unspecified role prey prey infection infection physical association physical association Fig. 4b rep-e-1 2 5 unspecified role unspecified role prey prey infection infection 6 unspecified role unspecified role bait bait infection infection physical association physical association Fig. 4b e-rep-7 1 5 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated UB1-AC sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain UB1-AC required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 6 unspecified role unspecified role bait bait purified purified c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 5a-b, 6a-b e-rep-8 3 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component infection infection colocalization colocalization Fig. 7.