IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Only protein-protein interactions imex curation crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Accepted 2021-DEC-22 AT 07:44 GMT AT 07:44 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Accepted 2021-DEC-22 AT 07:44 GMT AT 07:44 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Only protein-protein interactions imex curation crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Accepted 2021-DEC-22 AT 07:44 GMT AT 07:44 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. nicole.thielens@ibs.fr Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lacroix M., Dumestre-Pérard C., Schoehn G., Houen G., Cesbron JY., Arlaud GJ., Thielens NM. I found figure 6 very confusing, it is possible they have not entered the constructs used correctly (???) Figure 6 results: Details for full length MASP1 and MASP1/3 CUB-EGF constructs were found in Ref. 29 (Thielens et al.-2001 pmid:11290788). Details for full length MASP3 were found in Ref. 31 Zundel et al. -2004 pmid;15034049. Details of MASP1/3 CUB1-EGF-CUB2 construct was found in Ref. 30 Cseh et al. pmid: 12421953. The MASP1/3 CUB-EGF construct primers mapped to residues 1-184, not 1-185 as expected. nicole.thielens@ibs.fr Accepted 2021-DEC-22 AT 07:44 GMT AT 07:44 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation masp1_human Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN 5B37C7FB9F51FD1D o75636-pro_0000009142 Ficolin-3 FCN3 FCNH HAKA1 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen protein protein human Homo sapiens Human QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 24 299 727A85B6EBF4B046 p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER 09B5297A6C14283A o00187-2 Mannan-binding lectin serine protease 2 MASP2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MAp19 Small MBL-associated protein sMAP protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSEQSL 73B133D56FB229C2 albu_bovin Albumin ALB BSA protein protein bovin Bos taurus (Bovine) Bovine MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA 39167DFE768585D4 o00187-1 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF ED952085FA115E21 calr_human Calreticulin CRP55 Calregulin HACBP Endoplasmic reticulum resident protein 60 grp60 CALR CRTC protein protein human Homo sapiens Human MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL BC37C3C0F1054FB2 q15485-pro_0000009139 Ficolin-2 37 kDa elastin-binding protein Collagen/fibrinogen domain-containing protein 2 EBP-37 Ficolin-B Ficolin-beta Hucolin L-ficolin Serum lectin p35 FCN2 FCNL protein protein human Homo sapiens Human LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA 26 313 288505F85171831A fcn3-fcn3-1 1 6 unspecified role unspecified role neutral component neutral component purified purified O75636-PRO_0000009142:p.Lys47Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 19:10:01 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 18:56:12 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' Fri Jan 28 18:19:40 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'O75636-PRO_0000009142:p.Lys47Gly' O75636-PRO_0000009142:p.Lys47Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 18:39:44 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' 6 unspecified role unspecified role neutral component neutral component purified purified O75636-PRO_0000009142:p.Lys47Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 19:17:16 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 19:50:57 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' O75636-PRO_0000009142:p.Lys47Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:14:15 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' direct interaction direct interaction 1 fcn2-1 1 12 unspecified role unspecified role neutral component neutral component purified purified Q15485-PRO_0000009139:p.Lys57Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 18:47:59 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' Q15485-PRO_0000009139:p.Lys57Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 18:42:42 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Ala' Q15485-PRO_0000009139:p.Lys57Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 20:02:04 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' 12 unspecified role unspecified role neutral component neutral component purified purified Q15485-PRO_0000009139:p.Lys57Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 19:42:33 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' Q15485-PRO_0000009139:p.Lys57Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 20:27:06 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Ala' Q15485-PRO_0000009139:p.Lys57Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:23:55 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' direct interaction direct interaction 2 fcn2-fcn2-1 3 12 unspecified role unspecified role neutral component neutral component purified purified 12 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 3 The views show either a parachute-like structure with, in most cases, four heads connected by a rod-like structure to a small globe at the opposite end, or six heads surrounding a central globe. fcn3-fcn3-2 3 6 unspecified role unspecified role neutral component neutral component purified purified 6 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 3 alb-fcn2-2 4 9 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 12 unspecified role unspecified role prey prey purified purified Q15485-PRO_0000009139:p.Lys57Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 20:08:57 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' Q15485-PRO_0000009139:p.Lys57Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 19:43:33 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Ala' Q15485-PRO_0000009139:p.Lys57Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 18:51:25 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 4, Table 1 alb-fcn3-1 4 9 unspecified role unspecified role bait bait purified purified region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum 6 unspecified role unspecified role prey prey purified purified O75636-PRO_0000009142:p.Lys47Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 18:44:22 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 20:17:45 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' O75636-PRO_0000009142:p.Lys47Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 18:44:04 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 4, Table 1 fcn2-masp2-2 4 10 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role bait bait purified purified Q15485-PRO_0000009139:p.Lys57Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 18:58:46 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' Q15485-PRO_0000009139:p.Lys57Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 20:19:26 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Ala' Q15485-PRO_0000009139:p.Lys57Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 20:00:02 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 5, Table 2 fcn2-masp2-3 4 8 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role bait bait purified purified Q15485-PRO_0000009139:p.Lys57Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 20:19:37 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' Q15485-PRO_0000009139:p.Lys57Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 20:03:34 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Ala' Q15485-PRO_0000009139:p.Lys57Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:00:29 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 5, Table 2 alb-fcn3-2 4 10 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 unspecified role unspecified role bait bait purified purified O75636-PRO_0000009142:p.Lys47Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 19:35:56 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 18:45:04 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' O75636-PRO_0000009142:p.Lys47Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:18:55 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 5, Table 2 fcn3-1 4 8 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 unspecified role unspecified role bait bait purified purified O75636-PRO_0000009142:p.Lys47Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 19:37:22 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 20:14:16 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' O75636-PRO_0000009142:p.Lys47Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:40:39 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 5, Table 2 fcn3-masp1-2 4 5 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 unspecified role unspecified role bait bait purified purified O75636-PRO_0000009142:p.Lys47Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 20:20:51 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Table 3 Table 3 gives results for full length MASP1, but no results are present in Figure 6 for this molecule. fcn3-masp1-1 4 7 unspecified role unspecified role prey prey purified purified CUB-EGF sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 6 unspecified role unspecified role bait bait purified purified O75636-PRO_0000009142:p.Lys47Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 18:58:02 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 19:41:02 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' O75636-PRO_0000009142:p.Lys47Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:08:38 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 6 B/D, Table 3 Figure 6D:the WT CUB-EGF construct did bind to H-Ficolin but the data could not be analysed as there was no fit using the Langmuir 1:1 model. The CUB-EGF construct mutants K47A and K47R did not bind. fcn2-masp1-1 4 5 unspecified role unspecified role prey prey purified purified CUB1-EGF-CUB2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain CUB1-EGF sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role bait bait purified purified Q15485-PRO_0000009139:p.Lys57Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:14:43 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Table 3, Figure 6 A/C Table 3 gives results for full length MASP1, but no results are present in Figure 6 for this molecule. The Kd for the K57R mutant in the CUB1-EGF-CUB2 construct was 65.2 E-9. No binding was detected for the K57R mutant in the CUB1-EGF construct. No binding was detected for K57A or K57E mutants, when used. fcn2-masp1-2 4 7 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role bait bait purified purified Q15485-PRO_0000009139:p.Lys57Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 19:54:12 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction Table 3 Table 3 gives results for full length MASP3, but no results are present in Figure 6 for this molecule. alb-fcn2-3 2 11 unspecified role unspecified role bait bait purified purified human-placenta Homo sapiens placenta placenta 12 unspecified role unspecified role prey prey purified purified Q15485-PRO_0000009139:p.Lys57Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 20:25:49 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Glu' Q15485-PRO_0000009139:p.Lys57Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 18:53:24 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Ala' Q15485-PRO_0000009139:p.Lys57Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D Thu Jan 06 18:32:46 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys57Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 8 alb-fcn3-3 2 11 unspecified role unspecified role bait bait purified purified human-placenta Homo sapiens placenta placenta 6 unspecified role unspecified role prey prey purified purified O75636-PRO_0000009142:p.Lys47Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Thu Jan 06 18:26:04 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Ala' O75636-PRO_0000009142:p.Lys47Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Thu Jan 06 19:02:34 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Glu' O75636-PRO_0000009142:p.Lys47Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 20:18:27 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys47Arg' crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 8