IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. Nature medicine 2007 imex curation Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. Details of Biotinylated MIF were obtained from pmid:9315691 Transfected CXCR2 was determined to be of Human origin from references stated in Ref.43. jbernhagen@ukaachen.de,cweber@ukaachen.de Accepted 2020-AUG-12 AT 10:39 BST AT 10:39 BST by ORCHARD Nature medicine 2007 Only protein-protein interactions imex curation imex curation MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. Nature medicine 2007 imex curation Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-L1.2 L1.2 pre-B lymphoma/leukemia l1.2 L1.2 pre-B lymphoma/leukemia CVCL_9576 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de Accepted 2020-AUG-12 AT 10:39 BST AT 10:39 BST by ORCHARD Nature medicine 2007 Only protein-protein interactions imex curation imex curation MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. Nature medicine 2007 imex curation Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. Transfected CD74 is stated to be of Human origin in the supplement ("plasmid pcDNA3.1/V5-HisTOPO-TA-CD74 .... to express tagged human CD74." However the main Methods section states that:- "....immunoblotting with an antibody to mouse CD74." jbernhagen@ukaachen.de,cweber@ukaachen.de Accepted 2020-AUG-12 AT 10:39 BST AT 10:39 BST by ORCHARD Nature medicine 2007 Only protein-protein interactions imex curation imex curation MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. Nature medicine 2007 imex curation Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de Accepted 2020-AUG-12 AT 10:39 BST AT 10:39 BST by ORCHARD Nature medicine 2007 Only protein-protein interactions imex curation imex curation MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. MIF is a noncognate ligand of CXC chemokine receptors in inflammatory and atherogenic cell recruitment. Nature medicine 2007 imex curation Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bernhagen J., Krohn R., Lue H., Gregory JL., Zernecke A., Koenen RR., Dewor M., Georgiev I., Schober A., Leng L., Kooistra T., Fingerle-Rowson G., Ghezzi P., Kleemann R., McColl SR., Bucala R., Hickey MJ., Weber C. jbernhagen@ukaachen.de,cweber@ukaachen.de Accepted 2020-AUG-12 AT 10:39 BST AT 10:39 BST by ORCHARD Nature medicine 2007 Only protein-protein interactions imex curation imex curation mif_human Macrophage migration inhibitory factor MIF MMIF GLIF Phenylpyruvate tautomerase Glycosylation-inhibiting factor L-dopachrome tautomerase L-dopachrome isomerase protein protein human Homo sapiens Human MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA DIP protein P14174 original sequence version: 138 DIP protein P14174 original sequence version: 186 56D51107C05286B2 hg2a_human HLA class II histocompatibility antigen gamma chain DHLAG HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain CD74 protein protein human Homo sapiens Human MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM 27A13F252D5FB91D cxcr2_human C-X-C chemokine receptor type 2 CXCR2 IL8RB CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B IL-8 receptor type 2 protein protein human Homo sapiens Human MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL DIP protein P25025 original sequence version: 138 564F04A8BCC0A197 hg2a_mouse H-2 class II histocompatibility antigen gamma chain Cd74 Ii MHC class II-associated invariant chain Ia antigen-associated invariant chain protein protein mouse Mus musculus Mouse MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL mint Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place 300A85014F170792 mif-cxcr2-1 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4E cd74-cxcr2-1 4 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed colocalization colocalization 4F We studied the colocalization of endogenous CD74 and CXCR2 by confocal fluorescence microscopy in RAW264.7 macrophages expressing human CXCR2. We detected prominent colocalization, Prominent colocalization was seen in RAW264.7 macrophages of endogenous CD74 and over-expressed Human CXCR2. cd74-cxcr2-2 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4G, number 1 cd74-cxcr2-3 5 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4G, number 2 cxcr2-cd74-1 2 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 4H