IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Induction of apoptosis by the severe acute respiratory syndrome coronavirus 7a protein is dependent on its interaction with the Bcl-XL protein. Induction of apoptosis by the severe acute respiratory syndrome coronavirus 7a protein is dependent on its interaction with the Bcl-XL protein. Journal of virology 2007 imex curation Tan YX., Tan TH., Lee MJ., Tham PY., Gunalan V., Druce J., Birch C., Catton M., Fu NY., Yu VC., Tan YJ. Coronavirus - Interactions investigated in the context of Coronavirus mcbtanyj@imcb.a-star.edu.sg 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Tan YX., Tan TH., Lee MJ., Tham PY., Gunalan V., Druce J., Birch C., Catton M., Fu NY., Yu VC., Tan YJ. Coronavirus - Interactions investigated in the context of Coronavirus mcbtanyj@imcb.a-star.edu.sg Accepted 2020-MAR-31 AT 13:49 BST AT 13:49 BST by MARTA Journal of virology 2007 Only protein-protein interactions imex curation imex curation Induction of apoptosis by the severe acute respiratory syndrome coronavirus 7a protein is dependent on its interaction with the Bcl-XL protein. Induction of apoptosis by the severe acute respiratory syndrome coronavirus 7a protein is dependent on its interaction with the Bcl-XL protein. Journal of virology 2007 imex curation Tan YX., Tan TH., Lee MJ., Tham PY., Gunalan V., Druce J., Birch C., Catton M., Fu NY., Yu VC., Tan YJ. Coronavirus - Interactions investigated in the context of Coronavirus mcbtanyj@imcb.a-star.edu.sg 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip antibody detection identification by antibody antibody detection Tan YX., Tan TH., Lee MJ., Tham PY., Gunalan V., Druce J., Birch C., Catton M., Fu NY., Yu VC., Tan YJ. Coronavirus - Interactions investigated in the context of Coronavirus mcbtanyj@imcb.a-star.edu.sg Accepted 2020-MAR-31 AT 13:49 BST AT 13:49 BST by MARTA Journal of virology 2007 Only protein-protein interactions imex curation imex curation a0a0d9rjz8_chlsb Apoptosis regulator Bcl-X BCL2L1 Bcl-2-like protein 1 protein protein chlsb chlsb Green monkey Cercopithecus sabaeus MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK 623C109508A6AFC0 b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 ns7a_sars ORF7a protein Accessory protein 7a Protein U122 Protein X4 7a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE b2la1_human Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein Protein GRS BCL2A1 BCL2L5 BFL1 GRS HBPA1 Bcl-2-like protein 5 protein protein human Homo sapiens Human MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC 329D98AF2BE07A0D b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK E09D3CDD851AE9BE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F bcl2l1-ns7a_cvhsa-2 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered Q07817:p.Tyr101Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y K Tue Mar 31 10:00:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr101lys' Tue Jun 30 16:36:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr101Lys' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 2A, Fig 3B, Fig5A, B, Fig 8 bcl2l1-rep-1 2 5 unspecified role unspecified role prey prey living cell living cell 3 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig 2 C bcl2-ns7a_cvhsa-1 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 8 bcl2-ns7a_cvhsa-2 1 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association Fig 8 bcl2a1-ns7a_cvhsa-1 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association Fig 8 bcl2l2-ns7a_cvhsa-1 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell engineered engineered tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2A, Fig 3B, Fig5A, B, Fig 8