UniProt UniProt http://www.uniprot.org Human M-ficolin is a secretory protein that activates the lectin complement pathway. Human M-ficolin is a secretory protein that activates the lectin complement pathway. Journal of immunology (Baltimore, Md. : 1950) 2005 imex curation Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay autoradiography autoradiography Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp Accepted 2020-OCT-20 AT 06:34 BST AT 06:34 BST by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2005 Only protein-protein interactions imex curation imex curation Human M-ficolin is a secretory protein that activates the lectin complement pathway. Human M-ficolin is a secretory protein that activates the lectin complement pathway. Journal of immunology (Baltimore, Md. : 1950) 2005 imex curation Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. I have not tried to capture the 'activated' MASPs as they are only identified by molecular weight and could equally well be degradation products fujita@fmu.ac.jp Accepted 2020-OCT-20 AT 06:34 BST AT 06:34 BST by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2005 Only protein-protein interactions imex curation imex curation Human M-ficolin is a secretory protein that activates the lectin complement pathway. Human M-ficolin is a secretory protein that activates the lectin complement pathway. Journal of immunology (Baltimore, Md. : 1950) 2005 imex curation Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Y., Endo Y., Iwaki D., Nakata M., Matsushita M., Wada I., Inoue K., Munakata M., Fujita T. fujita@fmu.ac.jp Accepted 2020-OCT-20 AT 06:34 BST AT 06:34 BST by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2005 Only protein-protein interactions imex curation imex curation masp1_human Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN 5B37C7FB9F51FD1D 6-sialyl-n-acetyllactosamine 6-Sialyl-N-acetyllactosamine 5-acetamido-3,5-dideoxy-D-glycero-beta-D-galacto-non-2-ulopyranosylonic acid-(2->6)-beta-D-galacto-hexopyranosyl-(1->4)-2-acetamido-2-deoxy-D-gluco-hexopyranose NeuAc(b2-6)Gal(b1-4)GlcNAc WURCS=2.0/3,3,2/[a2122h-1x_1-5_2*NCC/3=O][a2112h-1b_1-5][Aad21122h-2b_2-6_5*NCC/3=O]/1-2-3/a4-b1_b6-c2 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 184D24B371B251AB n-acetylgalactosamine N-acetylgalactosamine GalNAc 2-Acetamido-2-deoxygalactose N-Acetylchondrosamine N-Acetylgalactosamine 2-acetamido-2-deoxygalactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) o00187-2 Mannan-binding lectin serine protease 2 MASP2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MAp19 Small MBL-associated protein sMAP protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSEQSL 73B133D56FB229C2 o00187-1 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF ED952085FA115E21 masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint ED952085FA115E21 n-acetylglucosamine N-acetylglucosamine N-acetylglucosamines small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fcn1-masp1-1 3 4 unspecified role unspecified role bait bait partially purified partially purified human-serum Homo sapiens serum Serum 6 unspecified role unspecified role prey prey purified purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 3A,3C masp2-fcn1-1 3 10 unspecified role unspecified role bait bait partially purified partially purified human-serum Homo sapiens serum Serum 6 unspecified role unspecified role prey prey purified purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 3BA, 3D Both O00187-1 and O00187-2 were observed in the complex but it was not possible to know if one or both were interacting with the prey n_acetylglucosamine-1 2 6 unspecified role unspecified role prey prey partially purified partially purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 4 unspecified role unspecified role prey prey partially purified partially purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role prey prey partially purified partially purified human-serum Homo sapiens serum Serum 9 unspecified role unspecified role prey prey partially purified partially purified human-serum Homo sapiens serum Serum 11 unspecified role unspecified role bait bait association association Fig. 4 n_acetylglucosamine-fcn1-1 2 6 unspecified role unspecified role prey prey partially purified partially purified drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 11 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 4 n_acetylglucosamine-fcn1-2 1 6 unspecified role unspecified role prey prey partially purified partially purified region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 11 unspecified role unspecified role bait bait partially purified partially purified direct interaction direct interaction Fig. 6A, 6B n_acetyllactosamine-fcn1-1 1 6 unspecified role unspecified role prey prey partially purified partially purified region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role bait bait partially purified partially purified direct interaction direct interaction Fig. 6A 6_sialyl_n_acetyllactosamine-fcn1-1 1 6 unspecified role unspecified role prey prey partially purified partially purified region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 6A