DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conserved N-terminal cysteine dioxygenases transduce responses to hypoxia in animals and plants. Conserved N-terminal cysteine dioxygenases transduce responses to hypoxia in animals and plants. Science (New York, N.Y.) 2019 imex curation Masson N., Keeley TP., Giuntoli B., White MD., Puerta ML., Perata P., Hopkinson RJ., Flashman E., Licausi F., Ratcliffe PJ. peter.ratcliffe@ndm.ox.ac.uk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro oxidase oxidase assay oxidase predetermined predetermined participant predetermined Masson N., Keeley TP., Giuntoli B., White MD., Puerta ML., Perata P., Hopkinson RJ., Flashman E., Licausi F., Ratcliffe PJ. peter.ratcliffe@ndm.ox.ac.uk Accepted 2021-APR-29 AT 10:28 BST AT 10:28 BST by PPORRAS Science (New York, N.Y.) 2019 Only protein-protein interactions imex curation imex curation aedo_human 2-aminoethanethiol dioxygenase ADO C10orf22 Cysteamine dioxygenase protein protein human Homo sapiens Human MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP 6B496CCF16E92C9D rgs5_human Regulator of G-protein signaling 5 RGS5 protein protein human Homo sapiens Human MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK 2E08CB0179DE7687 rgs4_human Regulator of G-protein signaling 4 RGS4 protein protein human Homo sapiens Human MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA DIP protein P49798 original sequence version: 102 DIP protein P49798 original sequence version: 106 7713F1F7496A698B ado-rgs5-1 1 3 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified CysO2H CysO2H cyso2h L-cysteine sulfinic acid (2R)-2-amino-3-sulfinopropanoic acid 2-amino-2-carboxyethanesulfinic acid 2-amino-3-(dioxido-lambda(6)-sulfanyl)propanoic acid [tautomer] 2-amino-3-sulfonylpropanoic acid [tautomer] 3-sulfinoalanine 3-sulphinoalanine L-cysteine sulfinic acid MOD_RES Cysteine sulfinic acid (-SO2H) S-cysteinesulfinic acid S-sulfinocysteine cysteine sulphinic acid cysteine-S,S-dioxide [tautomer] CysO2H Dioxidation dihydroxy sulfinicacid modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain 2-15 binding region 2-15 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme unspecified role unspecified role purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) redox reaction oxidoreductase activity electron transfer reaction redox reaction Fig 3. Fig S14 ado-rgs4-1 1 4 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified 2-15 binding region 2-15 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain CysO2H CysO2H cyso2h L-cysteine sulfinic acid (2R)-2-amino-3-sulfinopropanoic acid 2-amino-2-carboxyethanesulfinic acid 2-amino-3-(dioxido-lambda(6)-sulfanyl)propanoic acid [tautomer] 2-amino-3-sulfonylpropanoic acid [tautomer] 3-sulfinoalanine 3-sulphinoalanine L-cysteine sulfinic acid MOD_RES Cysteine sulfinic acid (-SO2H) S-cysteinesulfinic acid S-sulfinocysteine cysteine sulphinic acid cysteine-S,S-dioxide [tautomer] CysO2H Dioxidation dihydroxy sulfinicacid modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme unspecified role unspecified role purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) redox reaction oxidoreductase activity electron transfer reaction redox reaction Fig S13, Fig S14