DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the tubulin tyrosine carboxypeptidase complex VASH1-SVBP. Crystal structure of the tubulin tyrosine carboxypeptidase complex VASH1-SVBP. Nature structural & molecular biology 2019 imex curation Adamopoulos A., Landskron L., Heidebrecht T., Tsakou F., Bleijerveld OB., Altelaar M., Nieuwenhuis J., Celie PHN., Brummelkamp TR., Perrakis A. a.perrakis@nki.nl 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Adamopoulos A., Landskron L., Heidebrecht T., Tsakou F., Bleijerveld OB., Altelaar M., Nieuwenhuis J., Celie PHN., Brummelkamp TR., Perrakis A. a.perrakis@nki.nl Accepted 2020-OCT-05 AT 09:00 BST AT 09:00 BST by LIVIAP Nature structural & molecular biology 2019 Only protein-protein interactions imex curation imex curation q7l8a9-1 Tubulinyl-Tyr carboxypeptidase 1 VASH1 KIAA1036 VASH Tubulin carboxypeptidase 1 Tyrosine carboxypeptidase 1 Vasohibin-1 protein protein human Homo sapiens Human MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRV CEE39875FA9DA70B svbp_human Small vasohibin-binding protein SVBP CCDC23 Coiled coil domain-containing protein 23 protein protein human Homo sapiens Human MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE 9B128ABBF6ECD858 svbp-vash1-1 1 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified Q7L8A9-1:p.Cys169Ala C169A mutation mutation mutation certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:06:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys169Ala' 1-315 binding region 1-315 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig 1b, Sup Tab 1