DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Isomerization of BRCA1-BARD1 promotes replication fork protection. Isomerization of BRCA1-BARD1 promotes replication fork protection. Nature 2019 imex curation Daza-Martin M., Starowicz K., Jamshad M., Tye S., Ronson GE., MacKay HL., Chauhan AS., Walker AK., Stone HR., Beesley JFJ., Coles JL., Garvin AJ., Stewart GS., McCorvie TJ., Zhang X., Densham RM., Morris JR. Constructs (tags and binding regions) confirmed with the authors. r.m.densham@bham.ac.uk; j.morris.3@bham.ac.uk 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Daza-Martin M., Starowicz K., Jamshad M., Tye S., Ronson GE., MacKay HL., Chauhan AS., Walker AK., Stone HR., Beesley JFJ., Coles JL., Garvin AJ., Stewart GS., McCorvie TJ., Zhang X., Densham RM., Morris JR. Constructs (tags and binding regions) confirmed with the authors. r.m.densham@bham.ac.uk; j.morris.3@bham.ac.uk Accepted 2019-JUL-30 AT 14:19 BST AT 14:19 BST by MGT Nature 2019 Only protein-protein interactions imex curation imex curation there' s no valid interaction in ext data 6g as two proteins are flag- tagged in a flag tag coip (same reason I've had to get rid of one of the his tag pulldowns) the interaction here is in ext data 3g. I've just merged the two into one and made mutation into mutation with no effect ; I do consistently skip small molecules/cofactors/reagents/modifiers/etc (unless they are demonstrated to modify one of the proteins - then the ptm goes in but only it it is somehow detected) so no hydroxyurea, no CIP and no other factors/drugs/etc. EBI-21913671 vs EBI-21498364. ok, I've made S114D into "mutation increasing" (although I'm not that convinced - there's also difference in hte input panel; tha paer says nothing about increase) however I don't think the interactions can be merged as two features of different type are interpreted as present in the same construct mutations 114 & 148 were not. EBI-21913726 vs EBI-21913763: yup. one io these is gone. it''s hard to track interaction when a list is long and does not fit on the screen; editor not remembering i want to see more than 10 interaction at a time and forgetting which interactions were open/closed does not help :o/ Ext Data 4h - omitted interaction with S114A BRCA1 mutation: that's true. now it's there. The (2) Kinase assays could be added in EXt.Data 4K/I as the Kinase complexes are available in complex portal so can be imported as an interactors: sorry, I don't deal with complexes. Personally I would prefer to add this as a binary kinase-substrate interaction provided there are some rules specifying how to deal with a presence of non-kinase proteins. using complexes as interactors opens a can of worms (what if one of the proteins in the complex is is mutated/phosphorylated ? what if different proteins in the complex were made in different species ?) complexes are good for modelling but not for reporting experimental results. EBI-21913641: this one is actually not valid :o( there are actually two his-tagged proteins in a his tag pulldown so it's.... EBI-21498386: The p.Pro115Ala mutation is "increasing" not "causing": this is fine. but then it's got to be split into two interactions as 'increasing' and 'causing' are of different type. I've never signed up for annotating anything other than proteins that directly participate in interactions so I do not annotate/comment on ancillary proteins. EBI-21913797:- the main text for EXt.Data Fig 6D/E states the P115A mutation is increasing:- "but the interaction was stronger for the heterodimers that contained BRCA1(P115A) (Extended Data Fig. 6d, e).: P115A is indeed increasing binary Brca1-Rad51 interaction but the annotated interaction is ternary. it seems that there's actually less Bard1 binding to the mutant Brca1 so I'd rather leave it as is. could have been worse. it was a rather painful paper :o/ Isomerization of BRCA1-BARD1 promotes replication fork protection. Isomerization of BRCA1-BARD1 promotes replication fork protection. Nature 2019 imex curation Daza-Martin M., Starowicz K., Jamshad M., Tye S., Ronson GE., MacKay HL., Chauhan AS., Walker AK., Stone HR., Beesley JFJ., Coles JL., Garvin AJ., Stewart GS., McCorvie TJ., Zhang X., Densham RM., Morris JR. Constructs (tags and binding regions) confirmed with the authors. r.m.densham@bham.ac.uk; j.morris.3@bham.ac.uk 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Daza-Martin M., Starowicz K., Jamshad M., Tye S., Ronson GE., MacKay HL., Chauhan AS., Walker AK., Stone HR., Beesley JFJ., Coles JL., Garvin AJ., Stewart GS., McCorvie TJ., Zhang X., Densham RM., Morris JR. Constructs (tags and binding regions) confirmed with the authors. r.m.densham@bham.ac.uk; j.morris.3@bham.ac.uk Accepted 2019-JUL-30 AT 14:19 BST AT 14:19 BST by MGT Nature 2019 Only protein-protein interactions imex curation imex curation there' s no valid interaction in ext data 6g as two proteins are flag- tagged in a flag tag coip (same reason I've had to get rid of one of the his tag pulldowns) the interaction here is in ext data 3g. I've just merged the two into one and made mutation into mutation with no effect ; I do consistently skip small molecules/cofactors/reagents/modifiers/etc (unless they are demonstrated to modify one of the proteins - then the ptm goes in but only it it is somehow detected) so no hydroxyurea, no CIP and no other factors/drugs/etc. EBI-21913671 vs EBI-21498364. ok, I've made S114D into "mutation increasing" (although I'm not that convinced - there's also difference in hte input panel; tha paer says nothing about increase) however I don't think the interactions can be merged as two features of different type are interpreted as present in the same construct mutations 114 & 148 were not. EBI-21913726 vs EBI-21913763: yup. one io these is gone. it''s hard to track interaction when a list is long and does not fit on the screen; editor not remembering i want to see more than 10 interaction at a time and forgetting which interactions were open/closed does not help :o/ Ext Data 4h - omitted interaction with S114A BRCA1 mutation: that's true. now it's there. The (2) Kinase assays could be added in EXt.Data 4K/I as the Kinase complexes are available in complex portal so can be imported as an interactors: sorry, I don't deal with complexes. Personally I would prefer to add this as a binary kinase-substrate interaction provided there are some rules specifying how to deal with a presence of non-kinase proteins. using complexes as interactors opens a can of worms (what if one of the proteins in the complex is is mutated/phosphorylated ? what if different proteins in the complex were made in different species ?) complexes are good for modelling but not for reporting experimental results. EBI-21913641: this one is actually not valid :o( there are actually two his-tagged proteins in a his tag pulldown so it's.... EBI-21498386: The p.Pro115Ala mutation is "increasing" not "causing": this is fine. but then it's got to be split into two interactions as 'increasing' and 'causing' are of different type. I've never signed up for annotating anything other than proteins that directly participate in interactions so I do not annotate/comment on ancillary proteins. EBI-21913797:- the main text for EXt.Data Fig 6D/E states the P115A mutation is increasing:- "but the interaction was stronger for the heterodimers that contained BRCA1(P115A) (Extended Data Fig. 6d, e).: P115A is indeed increasing binary Brca1-Rad51 interaction but the annotated interaction is ternary. it seems that there's actually less Bard1 binding to the mutant Brca1 so I'd rather leave it as is. could have been worse. it was a rather painful paper :o/ Isomerization of BRCA1-BARD1 promotes replication fork protection. Isomerization of BRCA1-BARD1 promotes replication fork protection. Nature 2019 imex curation Daza-Martin M., Starowicz K., Jamshad M., Tye S., Ronson GE., MacKay HL., Chauhan AS., Walker AK., Stone HR., Beesley JFJ., Coles JL., Garvin AJ., Stewart GS., McCorvie TJ., Zhang X., Densham RM., Morris JR. Constructs (tags and binding regions) confirmed with the authors. r.m.densham@bham.ac.uk; j.morris.3@bham.ac.uk 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Daza-Martin M., Starowicz K., Jamshad M., Tye S., Ronson GE., MacKay HL., Chauhan AS., Walker AK., Stone HR., Beesley JFJ., Coles JL., Garvin AJ., Stewart GS., McCorvie TJ., Zhang X., Densham RM., Morris JR. Constructs (tags and binding regions) confirmed with the authors. r.m.densham@bham.ac.uk; j.morris.3@bham.ac.uk Accepted 2019-JUL-30 AT 14:19 BST AT 14:19 BST by MGT Nature 2019 Only protein-protein interactions imex curation imex curation there' s no valid interaction in ext data 6g as two proteins are flag- tagged in a flag tag coip (same reason I've had to get rid of one of the his tag pulldowns) the interaction here is in ext data 3g. I've just merged the two into one and made mutation into mutation with no effect ; I do consistently skip small molecules/cofactors/reagents/modifiers/etc (unless they are demonstrated to modify one of the proteins - then the ptm goes in but only it it is somehow detected) so no hydroxyurea, no CIP and no other factors/drugs/etc. EBI-21913671 vs EBI-21498364. ok, I've made S114D into "mutation increasing" (although I'm not that convinced - there's also difference in hte input panel; tha paer says nothing about increase) however I don't think the interactions can be merged as two features of different type are interpreted as present in the same construct mutations 114 & 148 were not. EBI-21913726 vs EBI-21913763: yup. one io these is gone. it''s hard to track interaction when a list is long and does not fit on the screen; editor not remembering i want to see more than 10 interaction at a time and forgetting which interactions were open/closed does not help :o/ Ext Data 4h - omitted interaction with S114A BRCA1 mutation: that's true. now it's there. The (2) Kinase assays could be added in EXt.Data 4K/I as the Kinase complexes are available in complex portal so can be imported as an interactors: sorry, I don't deal with complexes. Personally I would prefer to add this as a binary kinase-substrate interaction provided there are some rules specifying how to deal with a presence of non-kinase proteins. using complexes as interactors opens a can of worms (what if one of the proteins in the complex is is mutated/phosphorylated ? what if different proteins in the complex were made in different species ?) complexes are good for modelling but not for reporting experimental results. EBI-21913641: this one is actually not valid :o( there are actually two his-tagged proteins in a his tag pulldown so it's.... EBI-21498386: The p.Pro115Ala mutation is "increasing" not "causing": this is fine. but then it's got to be split into two interactions as 'increasing' and 'causing' are of different type. I've never signed up for annotating anything other than proteins that directly participate in interactions so I do not annotate/comment on ancillary proteins. EBI-21913797:- the main text for EXt.Data Fig 6D/E states the P115A mutation is increasing:- "but the interaction was stronger for the heterodimers that contained BRCA1(P115A) (Extended Data Fig. 6d, e).: P115A is indeed increasing binary Brca1-Rad51 interaction but the annotated interaction is ternary. it seems that there's actually less Bard1 binding to the mutant Brca1 so I'd rather leave it as is. could have been worse. it was a rather painful paper :o/ bard1_human BRCA1-associated RING domain protein 1 BARD1 RING-type E3 ubiquitin transferase BARD1 protein protein human Homo sapiens Human MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNMAVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS DIP protein Q99728 original sequence version: 118 95E2D904046B5646 brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY DIP protein P38398 original sequence version: 183 DIP protein P38398 original sequence version: 111 DIP protein P38398 original sequence version: 149 DIP protein P38398-1 original sequence version: 149 DIP protein P38398 original sequence version: 142 DIP protein P38398 original sequence version: 212 DIP protein P38398 original sequence version: 163 DIP protein P38398 original sequence version: 185 DIP protein P38398 original sequence version: 148 DIP protein P38398 original sequence version: 210 89C6D83FF56312AF p38398-1 Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY 89C6D83FF56312AF q06609-1 DNA repair protein RAD51 homolog 1 RAD51 homolog A RAD51 RAD51A RECA protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD DIP protein Q06609-1 original sequence version: 154 DIP protein Q06609-1 original sequence version: 85 DIP protein Q06609-1 original sequence version: 121 DIP protein Q06609-1 original sequence version: 155 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 q99728-1 BRCA1-associated RING domain protein 1 RING-type E3 ubiquitin transferase BARD1 FL BARD1 protein protein human Homo sapiens Human MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSYEFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNMAVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS 95E2D904046B5646 bard1-brca1-4 2 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level native native human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level native native human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 9 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range RFP Tag RFP Tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association Fig 1d pin1-brca1-2 3 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range eGFP Tag eGFP Tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13526:p.Trp34Ala W34A mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 17:39:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp34Ala' 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 1e brca1-rad51-1 3 4 unspecified role unspecified role ancillary ancillary purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-500 binding region 1-500 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P38398-1:p.Pro115Ala P115A mutation mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 18:03:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro115Ala' ecoli Escherichia coli (strain K12) physical association physical association Fig 3b brca1-bard1-15 1 4 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey native native human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed native native FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range eGFP Tag eGFP Tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P38398-1:p.Ser114Ala S114A mutation mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:39:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser114Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Ext Data Fig 3g pin1-brca1-3 3 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range eGFP Tag eGFP Tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P38398-1:p.Ser114Asp S114D mutation mutation increasing strength mutation increasing interaction strength mutation increasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D Tue Jun 30 15:48:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser114Asp' P38398-1:p.Ser114Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 16:13:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser114Ala' human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 1E, Ext Data Fig 4b,c,d pin1-brca1-4 3 5 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey native native human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13526:p.Trp34Ala W34A mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 17:02:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp34Ala' 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Ext Data Fig 4e calf intestinal phosphatase pin1-brca1-5 3 9 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range RFP Tag RFP Tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13526:p.Trp34Ala W34A mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 20:23:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp34Ala' 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Ext Data Fig 4f pin1-bard1-1 3 9 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range RFP Tag RFP Tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q99728-1:p.Ser148Ala S148A mutation mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:09:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser148Ala' human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13526:p.Trp34Ala W34A mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 15:51:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp34Ala' 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Ext Data Fig 4f pin1-bard1-2 3 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13526:p.Trp34Ala W34A mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 17:25:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp34Ala' 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range RFP Tag RFP Tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference physical association physical association Ext Data Fig 4f pin1-brca1-6 3 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range eGFP Tag eGFP Tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q13526:p.Trp34Ala W34A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 19:03:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp34Ala' GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Ext Data 4h,i brca1-bard1-16 3 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Step Tag Step Tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P38398-1:p.Pro115Ala P115A mutation mutation increasing strength mutation increasing interaction strength mutation increasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 17:56:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro115Ala' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Ext Data Fig 6d brca1-rad51-3 3 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-500 binding region 1-500 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P38398-1:p.Ser114Asp S114D mutation mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D Tue Jun 30 15:37:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser114Asp' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role ancillary ancillary purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Ext Data Fig 6a Binding only took place when GST–PIN1 was present. pin1-brca1-7 3 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range eGFP Tag eGFP Tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P38398-1:p.Ser114Ala S114A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:54:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser114Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-40 binding region 1-40 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Ext Data 4h,i CDK1 siRNA