DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Nature 2019 imex curation Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. For discussion in IMEx meeting: host organism ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu Accepted 2019-NOV-04 AT 11:56 GMT AT 11:56 GMT by PPORRAS Nature 2019 Only protein-protein interactions imex curation imex curation Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Nature 2019 imex curation Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. Cross-linking agent: Light (photocrosslinking) E. coli LptB2FGC complexes were photocrosslinked in vivo and adducts were detected by pulling down His-tagged protein, detecting interacting partners via immunoblotting with antibodies against LptC, LptF and LptG. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu Accepted 2019-NOV-04 AT 11:56 GMT AT 11:56 GMT by PPORRAS Nature 2019 Only protein-protein interactions imex curation imex curation Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Nature 2019 imex curation Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu Accepted 2019-NOV-04 AT 11:56 GMT AT 11:56 GMT by PPORRAS Nature 2019 Only protein-protein interactions imex curation imex curation Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Structural basis of unidirectional export of lipopolysaccharide to the cell surface. Nature 2019 imex curation Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down experimental particp experimental participant identification experimental particp Owens TW., Taylor RJ., Pahil KS., Bertani BR., Ruiz N., Kruse AC., Kahne D. ruiz.82@osu.edu; andrew_kruse@hms.harvard.edu; kahne@chemistry.harvard.edu Accepted 2019-NOV-04 AT 11:56 GMT AT 11:56 GMT by PPORRAS Nature 2019 Only protein-protein interactions imex curation imex curation a0a0h3cqa2_entcc ECL_04592 protein protein entcc Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) MQAFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDALGAGMYTLLSVPKDVQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRLQVALSVMKTAIPLVLLTMAIGEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGQNFVYIERVKGDDELGGVSIYAFNDERRLQSVRHASSAKFDPEHKQWRLSQVDESDLTNPKQITGSQTVSGTWKTNLTPDKLGVVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPMSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIIGALLPSASFLLISLWLLLKRS 92E9DC5F84A5E8C8 a0a0h3cr83_entcc Lipopolysaccharide export system ATP-binding protein LptB ECL_04583 protein protein entcc Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDEDISLLPLHARARRGIGYLPQEASIFRRLSVFDNLMAVLQIRDDLTSEQRQDRANELMEEFHIEHLRDSLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGNLIAHGTPQQILEDDHVKRVYLGEDFRL FAAAB17C487B274C q9kp75_vibch Lipopolysaccharide export system permease protein LptF VC_2500 protein protein vibch Vibrio cholerae MIIVRYLIRETIKSQFAIFFVLFLVFLSQKFIRVLADASDGEIPTSMILSIVGLNMPAMGLLMLPLSLYIGILLTFGRLYAESEITVMNATGIGNKFLIRAALYLALITASVAAFNALWLAPWSQDKEAHLMEQFAAENSVDLLQKGHFQRSPDGSSVVFIDNIENRKLYNVFVAQLAPRDSILPSVMFSHSGDVKELSDGRQIITLYDGTRYEGVPTRVDYMITNFDSYDGLIGQREVKSAERDWEALPTLSLLNNADRRAQAELQWRISLVVCIPLLTMLVVPLSAVNPRQGRFAKMGPAILIYLTYFLALSATKSAIEDGSLPVIIGLWPINAALLLAALMVNTLDSIPVRRFKDRWKQRKVA 5DAFED05F3E108B9 q9kp51_vibch Lipopolysaccharide export system protein LptC lptC VC_2525 protein protein vibch Vibrio cholerae MSLSRIVYVLLLFIASWSLYYLLGQEQDSKIQVAPNLELPMFSGENLENISYDEQGIRNYVITSIHLDHYAKSGNTLFKAPILKVYREGTLQEWEITARRGILSKDQVLTLYDDVLAKNLLPDSGFDTLTTSEMSIQLKSRDFWADKPVELRGPQFETHGQAMKGNFADHSAELYNQVQGRYETLTP D6F863E6C6562A8B q9kp76_vibch VC_2499 protein protein vibch Vibrio cholerae MFKILDWYIGRTIVATTALVLVTFVGLSGIIKYVEQLRKVGEGSYDLLQALLFVVLSIPRDVEMFFPMAALLGALIGLGALASSSELVVMQAAGFSKLDIGLSVLKTAIPLMIIVTLLGEWGAPQAQKMARDMRAFATSGGAIMSVRTGVWARDANDFIFIAKVENEHLYGLNLWRFDENKKLSTVIFSEQVDYVANNEWLMKDAVLTRLVNDIEISKESLPEYRWRTSLAPDKLAVVTVKPEELSLTGLSDYVHYLKASEQDSSRYELALWRKVTQPISIAVMMLMALSFIFGPLRSVTMGARILSGVIAGFSFYISSEFFGPLSLVYGLPPLFGALAPSLVFLAIALGLLGRKL A7C453F49B914EB2 a0a0h3cu18_entcc Lipopolysaccharide export system protein LptC lptC ECL_04581 protein protein entcc Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) MSKTRRWVIILLSLVALILIGVNLADRDDTQTEVINNNDPTYKSDHSDTVVYSPEGALNYRLIAQHVEYFSDDGISWFTQPVMTTFDKDKVPTWSIKSDRAKLTNDRMLYLYGHVEVNALTADSQLRKITTDNAQINLVTQDVTSQDLVTLYGTTFNSSGLRMRGNLRSKNAELIEKVRTSYEIQNKQTQP AA14FF065E2A28A5 a0a7g3evd2_entcl Lipopolysaccharide export system protein LptA lptA CGS27_18880 HV217_21785 STN0717ENT60_39460 protein protein Enterobacter cloacae Enterobacter cloacae MKFKTNKLSLKVVIASALLAASLPALAVTGDTEQPIHIESDTQSLDMQGNVVTFTGNVVMTQGTIKINADKVVVTRPGGEQGKEIIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDLVILTGNAYLEQLDSNIKGDKITYLVKEQKMQASSEKGKRVTTVLVPSQLQDKNNGQAPAQKKSN 42358FA6242DCE3F o30650_vibcl Lipopolysaccharide export system ATP-binding protein LptB ERS013165_03177 ERS013166_03465 ERS013173_02621 ERS013193_02291 ERS013198_02841 ERS013200_02346 ERS013201_03537 ERS013202_03082 F0315_07135 lptB BC353_06960 FLM02_07035 D6U24_09180 EYB64_09405 F0M16_05740 F0H40_12040 FLM12_06135 FXE67_01580 HPY07_01815 protein protein vibcl vibcl MAILKAQHLAKSYKKRKVVSDVSLQVESGQIVGLLGPNGAGKTTSFYMIVGLVARDEGTITIDDNDISILPMHSRSRMGIGYLPQEASIFRKLSVEDNIMAVLQTREELTHEERQDKLEDLLEEFHIQHIRKSAGMALSGGERRRVEIARALAANPQFILLDEPFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPQDVLNNEQVKQVYLGEQFRL 53DEAB53FE284944 a0a421ify4_entcl Lipopolysaccharide export system permease protein LptF CP904_11410 D1176_20785 protein protein Enterobacter cloacae Enterobacter cloacae MIIIRYLVRETLKSQLAILFILLLIFFCQKLVKILGAAVDGEIPTNLVLSLLGLGIPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILALFTGIVAAVNVMWAGPMSSRHQDEVLAEAKANPGMAALAQGQFQQATDGNSVLFIESVDGSKFNDVFLAQLRTKGNARPSVVVADSGQLAQRKDGSQVVTLNKGTRFEGTAMLRDFRITDFQNYQAIIGHQAVALDPTDTEQMDMRTLWNTDTDRARAEFHWRITLVFTVFMMALIVVPLSVVNPRQGRVLSMLPAMLLYLIYFLLQTSIRSNGAKGKLDPMVWTWFVNSLYILLALGLNLWDTVPVRRIRARFSRKGAI 7E8F3C1E621F3DBC a0a0h3cqa2_entcc-a0a0h3cr83_entcc-1 1 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 13 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 10 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b, Extended Data Fig. 2, Supplementary Table 1 lptb-lptc-4 1 9 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 7 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 12 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 8 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1b, Extended Data Fig. 2, Supplementary Table 1 q9kp75_vibch-lptc-1 2 9 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 28 31 physical association physical association Fig. 2b, Extended Data Fig. 4a lptc-q9kp76_vibch-1 2 9 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified cross linker cross llinker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 37 34 physical association physical association Fig. 2b, Extended Data Fig. 4a lptc-q9kp75_vibch-2 2 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 43 40 physical association physical association Fig. 2b, Extended Data Fig. 4a, Extended Data Fig. 6f lptc-q9kp75_vibch-3 2 9 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 50 47 physical association physical association Fig. 2b, Extended Data Fig. 4a q9kp75_vibch-lptc-2 2 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cross linker cross linker cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2b, Extended Data Fig. 4a lptc-q9kp75_vibch-1 4 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig. 6f a0a0h3cqa2_entcc-a0a0h3cr83_entcc-5 3 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified A0A421IFY4:p.[Ser157Cys;Ile234Cys] S157C/I234C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S C certain certain sequence position certain certain certain sequence position certain I C Wed Sep 18 13:42:52 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser157Cys, Ile234Cys]' Tue Jun 30 19:46:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser157Cys;Ile234Cys]' flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A0A421IFY4:p.Ser157Cys S157C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S C Tue Jun 30 18:25:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser157Cys' A0A421IFY4:p.Ile234Cys I234C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I C Tue Jun 30 16:28:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile234Cys' ecoli Escherichia coli (strain K12) 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig. 9e (lanes 1-4) a0a421ify4_entcl-lpta_1-5 4 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 11 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4d WT a0a421ify4_entcl-lpta_1-1 4 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified A0A421IFY4:p.Ser157Cys S157C mutation mutation certain certain sequence position certain certain certain sequence position certain S C Tue Jun 30 19:40:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser157Cys' ecoli Escherichia coli (strain K12) 11 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4d (S157C) a0a421ify4_entcl-lpta_1-2 4 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified A0A421IFY4:p.Ile234Cys I234C mutation mutation certain certain sequence position certain certain certain sequence position certain I C Tue Jun 30 20:09:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile234Cys' ecoli Escherichia coli (strain K12) 11 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4d (I234C) a0a421ify4_entcl-lpta_1-3 4 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified A0A421IFY4:p.Ile234Cys I234C mutation mutation certain certain sequence position certain certain certain sequence position certain I C Tue Jun 30 18:31:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile234Cys' A0A421IFY4:p.Ser157Cys S157C mutation mutation certain certain sequence position certain certain certain sequence position certain S C Tue Jun 30 20:09:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser157Cys' ecoli Escherichia coli (strain K12) 11 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4d (S157C+I234C)