DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the post-translational protein translocation machinery of the ER membrane. Structure of the post-translational protein translocation machinery of the ER membrane. Nature 2018 imex curation Wu X., Cabanos C., Rapoport TA., Wu X., Cabanos C., Rapoport TA. tom_rapoport@hms.harvard.edu. 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Wu X., Cabanos C., Rapoport TA., Wu X., Cabanos C., Rapoport TA. tom_rapoport@hms.harvard.edu. Accepted 2019-SEP-23 AT 12:32 BST AT 12:32 BST by ORCHARD Nature 2018 imex curation Structure of the post-translational protein translocation machinery of the ER membrane. Structure of the post-translational protein translocation machinery of the ER membrane. Nature 2018 imex curation Wu X., Cabanos C., Rapoport TA., Wu X., Cabanos C., Rapoport TA. tom_rapoport@hms.harvard.edu. 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Wu X., Cabanos C., Rapoport TA., Wu X., Cabanos C., Rapoport TA. tom_rapoport@hms.harvard.edu. Accepted 2019-SEP-23 AT 12:32 BST AT 12:32 BST by ORCHARD Nature 2018 imex curation sc6b1_yeast Protein transport protein SBH1 Sec61 complex subunit SBH1 YER087BC YER087C-B SBH1 SEB1 Sec61 complex subunit beta protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF 23B0313EB37744FA sec66_yeast Translocation protein SEC66 SEC71 YBR1232 YBR171W SEC66 HSS1 Sec62/63 complex 31.5 kDa subunit Protein HSS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEFNETKFSNNGTFFETEEPIVETKSISVYTPLIYVFILVVSLVMFASSYRKKQAKKISEQPSIFDENDAHDLYFQIKEMSENEKIHEKVLKAALLNRGAESVRRSLKLKELAPQINLLYKNGSIGEDYWKRFETEVKLIELEFKDTLQEAERLQPGWVQLFVMVCKEICFNQALSRRYQSILKRKEVCIKEWELKINNDGRLVN E2A8BB4994A227D4 E2A8BB4994A227D4 sec72_yeast Translocation protein SEC72 SEC67 SIM2 L8003.18 YLR292C SEC72 Sec62/63 complex 23 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTLEYNANSKLITASDAVVALSTETNIDQINVLTTSLIGETNPNFTPQPNEALSKMIKGLFESGMKNLQQKKLNEALKNVSLAIEMAQRKRAPWEAFAIQLPELHFMLRSKIDLCLILGKHLEALQDLDFLLGTGLIQPDVFVRKADCLLKLRQWEEARATCERGLALAPEDMKLRALLIETARNLAEYNGE D5D200DF2DCA81DB sec62_yeast Translocation protein SEC62 SEC62 YPL094C LPG14C Sec62/63 complex 30 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAVGPGSNAGASVNGGSATAIATLLRNHKELKQRQGLFQAKQTDFFRYKRFVRALHSEEYANKSARQPEIYPTIPSNKIEDQLKSREIFIQLIKAQMVIPVKKLHSQECKEHGLKPSKDFPHLIVSNKAQLEADEYFVWNYNPRTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYVSLGAFGILAGFFAVAILRLILYVLSLIVYKDVGGFWIFPNLFEDCGVLESFKPLYGFGEKDTYSYKKKLKRMKKKQAKRESNKKKAINEKAEQN 2B2BA0DAAF3ACCA1 sc61g_yeast Protein transport protein SSS1 Sec61 complex subunit SSS1 Ssh1 complex subunit SSS1 D4475 YDR086C SSS1 Sec61 complex subunit gamma Ssh1 complex subunit gamma protein protein yeast Saccharomyces cerevisiae Baker's yeast MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV 340F2EA913850D85 sec63_yeast Protein translocation protein SEC63 PTL1 YOR254C SEC63 NPL1 Sec62/63 complex 73 kDa subunit Protein NPL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPTNYEYDEASETWPSFILTGLLMVVGPMTLLQIYQIFFGANAEDGNSGKSKEFNEEVFKNLNEEYTSDEIKQFRRKFDKNSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNYLKYGHPDGPQSTSHGIALPRFLVDGSASPLLVVCYVALLGLILPYFVSRWWARTQSYTKKGIHNVTASNFVSNLVNYKPSEIVTTDLILHWLSFAHEFKQFFPDLQPTDFEKLLQDHINRRDSGKLNNAKFRIVAKCHSLLHGLLDIACGFRNLDIALGAINTFKCIVQAVPLTPNCQILQLPNVDKEHFITKTGDIHTLGKLFTLEDAKIGEVLGIKDQAKLNETLRVASHIPNLKIIKADFLVPGENQVTPSSTPYISLKVLVRSAKQPLIPTSLIPEENLTEPQDFESQRDPFAMMSKQPLVPYSFAPFFPTKRRGSWCCLVSSQKDGKILQTPIIIEKLSYKNLNDDKDFFDKRIKMDLTKHEKFDINDWEIGTIKIPLGQPAPETVGDFFFRVIVKSTDYFTTDLDITMNMKVRDSPAVEQVEVYSEEDDEYSTDDDETESDDESDASDYTDIDTDTEAEDDESPE 7D6757144C8A301F sc61a_yeast Protein transport protein SEC61 Sec61 complex subunit SEC61 L3502.5 YLR378C SEC61 Sec61 complex subunit alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNRVLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLLIFLILGQIPLYGIVSSETSDPLYWLRAMLASNRGTLLELGVSPIITSSMIFQFLQGTQLLQIRPESKQDRELFQIAQKVCAIILILGQALVVVMTGNYGAPSDLGLPICLLLIFQLMFASLIVMLLDELLSKGYGLGSGISLFTATNIAEQIFWRAFAPTTVNSGRGKEFEGAVIAFFHLLAVRKDKKRALVEAFYRTNLPNMFQVLMTVAIFLFVLYLQGFRYELPIRSTKVRGQIGIYPIKLFYTSNTPIMLQSALTSNIFLISQILFQKYPTNPLIRLIGVWGIRPGTQGPQMALSGLAYYIQPLMSLSEALLDPIKTIVYITFVLGSCAVFSKTWIEISGTSPRDIAKQFKDQGMVINGKRETSIYRELKKIIPTAAAFGGATIGALSVGSDLLGTLGSGASILMATTTIYGYYEAAAKEGGFTKNLVPGFSDLM AB34F12FB7B3CBD4 cryo-em-2 1 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native Flag Tag Flag Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig.1, Extended data figure 1. Extended data table 1 gel filtration-1 2 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native yeast Saccharomyces cerevisiae Baker's yeast 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified native native Flag Tag Flag Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig.1a