UniProt UniProt http://www.uniprot.org Paired Immunoglobulin-like Type 2 Receptor Alpha G78R variant alters ligand binding and confers protection to Alzheimer's disease. Paired Immunoglobulin-like Type 2 Receptor Alpha G78R variant alters ligand binding and confers protection to Alzheimer's disease. PLoS genetics 2018 imex curation Rathore N., Ramani SR., Pantua H., Payandeh J., Bhangale T., Wuster A., Kapoor M., Sun Y., Kapadia SB., Gonzalez L., Zarrin AA., Goate A., Hansen DV., Behrens TW., Graham RR. rrgraham94@gmail.com 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr antibody detection identification by antibody antibody detection Rathore N., Ramani SR., Pantua H., Payandeh J., Bhangale T., Wuster A., Kapoor M., Sun Y., Kapadia SB., Gonzalez L., Zarrin AA., Goate A., Hansen DV., Behrens TW., Graham RR. rrgraham94@gmail.com Accepted 2019-NOV-05 AT 13:45 GMT AT 13:45 GMT by PPORRAS PLoS genetics 2018 Only protein-protein interactions imex curation imex curation Paired Immunoglobulin-like Type 2 Receptor Alpha G78R variant alters ligand binding and confers protection to Alzheimer's disease. Paired Immunoglobulin-like Type 2 Receptor Alpha G78R variant alters ligand binding and confers protection to Alzheimer's disease. PLoS genetics 2018 imex curation Rathore N., Ramani SR., Pantua H., Payandeh J., Bhangale T., Wuster A., Kapoor M., Sun Y., Kapadia SB., Gonzalez L., Zarrin AA., Goate A., Hansen DV., Behrens TW., Graham RR. rrgraham94@gmail.com 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Rathore N., Ramani SR., Pantua H., Payandeh J., Bhangale T., Wuster A., Kapoor M., Sun Y., Kapadia SB., Gonzalez L., Zarrin AA., Goate A., Hansen DV., Behrens TW., Graham RR. rrgraham94@gmail.com Accepted 2019-NOV-05 AT 13:45 GMT AT 13:45 GMT by PPORRAS PLoS genetics 2018 Only protein-protein interactions imex curation imex curation a1z0p7_hhv1 Envelope glycoprotein B UL27 gB HHV1gp041 protein protein hhv1 Human herpesvirus 1 HHV-1 Human herpes simplex virus 1 MHQGAPSWGRRWFVVWALLGLTLGVLVASAAPSSPGTPGVAAATQAANGGPATPAPPALGAAPTGDPKPKKNKKPKNPTPPRPAGDNATVAAGHATLREHLRDIKAENTDANFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRSTAKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTMTKWQEVDEMLRSEYGGSFRFSSDAISTTFTTNLTEYPLSRVDLGDCIGKDARDAMDRIFARRYNATHIKVGQPQYYLANGGFLIAYQPLLSNTLAELYVREHLREQSRKPPNPTPPPPGASANASVERIKTTSSIEFARLQFTYNHIQRHVNDMLGRVAIAWCELQNHELTLWNEARKLNPNAIASVTVGRRVSARMLGDVMAVSTCVPVAADNVIVQNSMRISSRPGACYSRPLVSFRYEDQGPLVEGQLGENNELRLTRDAIEPCTVGHRRYFTFGGGYVYFEEYAYSHQLSRADITTVSTFIDLNITMLEDHEFVPLEVYTRHEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIHADANAAMFAGLGAFFEGMGDLGRAVGKVVMGIVGGVVSAVSGVSSFMSNPFGALAVGLLVLAGLAAAFFAFRYVMRLQSNPMKALYPLTTKELKNPTNPDASGEGEEGGDFDEAKLAEAREMIRYMALVSAMERTEHKAKKKGTSALLSAKVTDMVMRKRRNTNYTQVPNKDGDADEDDL 1EF0F2EDA4B8FACA pianp_human PILR alpha-associated neural protein PIANP C12orf53 PANP PILR-associating neural protein Paired immunoglobin-like type 2 receptor-associating neural protein UNQ828/PRO1755 protein protein human Homo sapiens Human MESRMWPALLLSHLLPLWPLLLLPLPPPAQGSSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNRIPLVNL 772F37069CE472C8 npdc1_human Neural proliferation differentiation and control protein 1 NPDC1 protein protein human Homo sapiens Human MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP 21D6512AD345A575 sorc1_human VPS10 domain-containing receptor SorCS1 SORCS1 SORCS protein protein human Homo sapiens Human MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRMQNCTEANRNQPFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANKKIDNQVKTFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDGIAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLRLSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPSTQPGDSSLRLQRARHATPPSTPKRGSAGAQYAI BAF8D4FB87A4F998 aplp1_human Amyloid beta precursor like protein 1 APLP1 Amyloid beta (A4) precursor-like protein 1 Amyloid-like protein 1 protein protein human Homo sapiens Human MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPGTPDPSGTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALNEHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP DIP protein P51693 original sequence version: 82 DIP protein P51693-1 original sequence version: 124 B95F0F4D1C5CBAC7 pilra_human Paired immunoglobulin-like type 2 receptor alpha PILRA Inhibitory receptor PILR-alpha Cell surface receptor FDF03 protein protein human Homo sapiens Human MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETAVGVAVAVTVLGIMILGLICLLRWRRRKGQQRTKATTPAREPFQNTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSPRAPPSHRPLKSPQNETLYSVLKA 77BD068C63274A40 co4a_human Complement C4-A C4A CO4 CPAMD2 Acidic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 protein protein human Homo sapiens Human MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVALGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV 9396A4CC4DA3602C npdc1-pilra-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9UKJ1:p.Ser80Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S G Tue Jun 30 19:33:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Gly' Q9UKJ1:p.Arg72Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 17:36:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Ala' Q9UKJ1:p.Phe76Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 18:06:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' Q9UKJ1:p.Arg78Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 16:19:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' Q9UKJ1:p.Gln140Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q A Tue Jun 30 15:50:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln140Ala' Q9UKJ1:p.Ser141Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:06:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser141Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role neutral component neutral component purified purified c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 1C, 3D, Supp Fig. 3 I've had to reverse engineer the R78G mutant to get a result - delete the mutation increasing if you don't approve. However Arg-78 is really the wild-type so Ser80 is also a mutation increasing, not decreasing. npdc1-pilra-2 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Ser80Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S G Tue Jun 30 17:03:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Gly' Q9UKJ1:p.Arg72Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 15:44:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Ala' Q9UKJ1:p.Phe76Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 20:05:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' Q9UKJ1:p.Arg78Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 20:12:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 1E, 2B Supp Fig. 4, 5 I've had to reverse engineer the R78G mutant to get a result - delete the mutation increasing if you don't approve. However Arg-78 is really the wild-type so Ser80 is also a mutation increasing, not decreasing. pilra-ul27-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Ser80Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S G Tue Jun 30 19:11:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Gly' Q9UKJ1:p.Arg72Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 18:20:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Ala' Q9UKJ1:p.Phe76Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 16:10:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' Q9UKJ1:p.Arg78Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 16:52:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 1F, Supp. FIg. 4 I've had to reverse engineer the R78G mutant to get a result - delete the mutation increasing if you don't approve. However Arg-78 is really the wild-type so Ser80 is also a mutation increasing, not decreasing. pianp-pilra-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Ser80Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S G Tue Jun 30 20:14:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Gly' Q9UKJ1:p.Arg72Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 17:18:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Ala' Q9UKJ1:p.Phe76Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 16:00:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' Q9UKJ1:p.Arg78Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 20:02:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 1G, Supp FIg. 4 I've had to reverse engineer the R78G mutant to get a result - delete the mutation increasing if you don't approve. However Arg-78 is really the wild-type so Ser80 is also a mutation increasing, not decreasing. pilra-sorcs1-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Arg78Gly mutation mutation certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 19:44:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal gd tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal gpi anchor fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2B aplp1-pilra-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Arg78Gly mutation mutation certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 19:19:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal gd tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal gpi anchor fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2B, Supp. Fig. 5 c4a-pilra-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Arg78Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 18:39:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' Q9UKJ1:p.Phe76Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 16:57:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe76Ala' Q9UKJ1:p.Ser80Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S G Tue Jun 30 19:23:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser80Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal gd tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal gpi anchor fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2B, 2C, Supp. Fig. 5 npdc1-pilra-3 1 8 unspecified role unspecified role bait bait purified purified c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region smyrres S-myristoylated residue SMyrRes certain certain sequence position certain certain certain sequence position certain Q9UKJ1:p.Gln140Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q A Tue Jun 30 18:05:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln140Ala' Q9UKJ1:p.Arg78Gly mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 19:35:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Gly' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role prey prey purified purified c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 3E