UniProt UniProt http://www.uniprot.org Visualization of Tau⁻Tubulin Interaction in a Living Cell Using Bifluorescence Complementation Technique. Visualization of Tau⁻Tubulin Interaction in a Living Cell Using Bifluorescence Complementation Technique. International journal of molecular sciences 2018 imex curation Shin S., Lim S., Jeong H., Kwan LT., Kim YK. yunkyungkim@kist.re.kr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Shin S., Lim S., Jeong H., Kwan LT., Kim YK. The BODIPY-fluorescence sensor (BD-tau) selectively responds to pathological tau aggregates yunkyungkim@kist.re.kr Accepted 2019-NOV-28 AT 15:46 GMT AT 15:46 GMT by PPORRAS International journal of molecular sciences 2018 Only protein-protein interactions imex curation imex curation Visualization of Tau⁻Tubulin Interaction in a Living Cell Using Bifluorescence Complementation Technique. Visualization of Tau⁻Tubulin Interaction in a Living Cell Using Bifluorescence Complementation Technique. International journal of molecular sciences 2018 imex curation Shin S., Lim S., Jeong H., Kwan LT., Kim YK. yunkyungkim@kist.re.kr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Shin S., Lim S., Jeong H., Kwan LT., Kim YK. yunkyungkim@kist.re.kr Accepted 2019-NOV-28 AT 15:46 GMT AT 15:46 GMT by PPORRAS International journal of molecular sciences 2018 Only protein-protein interactions imex curation imex curation tbb5_human Tubulin beta chain TUBB Tubulin beta-5 chain TUBB5 OK/SW-cl.56 protein protein human Homo sapiens Human MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA DIP protein P07437 original sequence version: 170 1E6CD0A36773A103 tba1a_human Tubulin alpha-1A chain TUBA1A Tubulin B-alpha-1 Tubulin alpha-3 chain Alpha-tubulin 3 TUBA3 protein protein human Homo sapiens Human MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY DIP protein Q71U36 original sequence version: 111 00F8429A4A10E5FE p10636-8 Microtubule-associated protein tau Tau-4 MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 2N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636-8 original sequence version: 206 DIP protein P10636-8 original sequence version: 203 DIP protein P10636-8 original sequence version: 166 DIP protein P10636-8 original sequence version: 218 835A8706D847A8CC tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636 original sequence version: 125 DIP protein P10636 original sequence version: 210 D46C66CDBCD196E8 tuba1a-tuba1a-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1C(i), 1E(i), Supp. Fig. 1D tuba1a-tuba1a-2 2 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1C(ii) tuba1a-tubb-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1C(iii), 1E(iii), Supp. Fig. 1D tuba1a-tubb-2 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1C(v), 1E(v) tuba1a-tubb-3 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1C(vi) mapt-tubb-1 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A(iii) mapt-tuba1a-1 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figs. 2A(v), 2F, 3B, 3D, 3F, 4A-C, Supp. Figs. 1D, 3 Taxol Vinblastine Nocodazole Forskolin Thapsigargin mapt-tuba1a-2 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-n venus n-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A(vi) mapt-mapt-3 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-n venus n-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4A, 4B, Supp. Fig. 3 Thapsigargin Forskolin tuba1a-tubb-4 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-n venus n-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig. 1D mapt-tuba1a-3 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp. Fig. 5 Prion-like tau seed (tauK18P301L) Thapsigargin (CHEBI:9516) Forskolin (CHEBI:42471)