IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TWEAK Negatively Regulates Human Dicer. TWEAK Negatively Regulates Human Dicer. Non-coding RNA 2016 imex curation Lambert M., Pépin G., Peralta-Zaragoza O., Matusiak R., Ly S., Landry P., Provost P. patrick.provost@crchudequebec.ulaval.ca 09-May-2019: Contacted by IntAct-Help. Yeast strain harboring the pGBT9-Dicer vector was transformed with a human lung cDNA library; The interacting plasmid from positive clones were subjected to sequencing of the cDNA inserts Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lambert M., Pépin G., Peralta-Zaragoza O., Matusiak R., Ly S., Landry P., Provost P. patrick.provost@crchudequebec.ulaval.ca Accepted 2019-FEB-25 AT 15:58 GMT AT 15:58 GMT by PPORRAS Yeast strain harboring the pGBT9-Dicer vector was transformed with a human lung cDNA library; The interacting plasmid from positive clones were subjected to sequencing of the cDNA inserts Non-coding RNA 2016 Only protein-protein interactions imex curation imex curation Exp preparation for flag construct corrected; Participant detection method corrected at experimental level and at participant level; Comment for full-length construct has been added; Participant detection method corrected; GO X'ref added at interaction level for cytoplasm and nucleus TWEAK Negatively Regulates Human Dicer. TWEAK Negatively Regulates Human Dicer. Non-coding RNA 2016 imex curation Lambert M., Pépin G., Peralta-Zaragoza O., Matusiak R., Ly S., Landry P., Provost P. patrick.provost@crchudequebec.ulaval.ca 09-May-2019: Contacted by IntAct-Help. Yeast strain harboring the pGBT9-Dicer vector was transformed with a human lung cDNA library; The interacting plasmid from positive clones were subjected to sequencing of the cDNA inserts Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Lambert M., Pépin G., Peralta-Zaragoza O., Matusiak R., Ly S., Landry P., Provost P. patrick.provost@crchudequebec.ulaval.ca Accepted 2019-FEB-25 AT 15:58 GMT AT 15:58 GMT by PPORRAS Yeast strain harboring the pGBT9-Dicer vector was transformed with a human lung cDNA library; The interacting plasmid from positive clones were subjected to sequencing of the cDNA inserts Non-coding RNA 2016 Only protein-protein interactions imex curation imex curation Exp preparation for flag construct corrected; Participant detection method corrected at experimental level and at participant level; Comment for full-length construct has been added; Participant detection method corrected; GO X'ref added at interaction level for cytoplasm and nucleus TWEAK Negatively Regulates Human Dicer. TWEAK Negatively Regulates Human Dicer. Non-coding RNA 2016 imex curation Lambert M., Pépin G., Peralta-Zaragoza O., Matusiak R., Ly S., Landry P., Provost P. patrick.provost@crchudequebec.ulaval.ca 09-May-2019: Contacted by IntAct-Help. Yeast strain harboring the pGBT9-Dicer vector was transformed with a human lung cDNA library; The interacting plasmid from positive clones were subjected to sequencing of the cDNA inserts Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lambert M., Pépin G., Peralta-Zaragoza O., Matusiak R., Ly S., Landry P., Provost P. patrick.provost@crchudequebec.ulaval.ca Accepted 2019-FEB-25 AT 15:58 GMT AT 15:58 GMT by PPORRAS Yeast strain harboring the pGBT9-Dicer vector was transformed with a human lung cDNA library; The interacting plasmid from positive clones were subjected to sequencing of the cDNA inserts Non-coding RNA 2016 Only protein-protein interactions imex curation imex curation Exp preparation for flag construct corrected; Participant detection method corrected at experimental level and at participant level; Comment for full-length construct has been added; Participant detection method corrected; GO X'ref added at interaction level for cytoplasm and nucleus tnf12_human Tumor necrosis factor ligand superfamily member 12 TNFSF12 APO3L DR3LG APO3 ligand TNF-related weak inducer of apoptosis UNQ181/PRO207 protein protein human Homo sapiens Human MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH E660843361C28EBA dicer_human Endoribonuclease Dicer DICER1 DICER HERNA KIAA0928 Helicase with RNase motif protein protein human Homo sapiens Human MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGNQLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS 9452B96A601D4551 dicer1-tnfsf12-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1 TWEAK did not interact with full-length Dicer construct dicer1-tnfsf12-2 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 4 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 2 dicer1-tnfsf12-3 1 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 3a