IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. Frontiers in molecular neuroscience 2017 imex curation Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it Accepted 2019-MAY-02 AT 14:37 BST AT 14:37 BST by PPORRAS Frontiers in molecular neuroscience 2017 Only protein-protein interactions imex curation imex curation Corrected: LRRK2 expressed in E.coli.; DNM1 exp. prep.; ser-616 feature role as observed ptm.; Corrected: Strep tag; data-processing added at publication level; Exp preps in LRRK2 in EBI-21224908 added; data-processing comment removed; Strep tag feature corrected; pSer position corrected and feature role added; G2019S mutation effect corrected; Feature updated: strep-flag tandem tag; Data-processing comment corrected; 1-912 captured as 'required to bind' and 913-2527 sufficient to bind feature deleted; strep-flag tag feature updated The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. Frontiers in molecular neuroscience 2017 imex curation Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro kinase spa kinase scintillation proximity assay kinase spa autoradiography autoradiography Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it Accepted 2019-MAY-02 AT 14:37 BST AT 14:37 BST by PPORRAS Frontiers in molecular neuroscience 2017 Only protein-protein interactions imex curation imex curation Corrected: LRRK2 expressed in E.coli.; DNM1 exp. prep.; ser-616 feature role as observed ptm.; Corrected: Strep tag; data-processing added at publication level; Exp preps in LRRK2 in EBI-21224908 added; data-processing comment removed; Strep tag feature corrected; pSer position corrected and feature role added; G2019S mutation effect corrected; Feature updated: strep-flag tandem tag; Data-processing comment corrected; 1-912 captured as 'required to bind' and 913-2527 sufficient to bind feature deleted; strep-flag tag feature updated The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. Frontiers in molecular neuroscience 2017 imex curation Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it Accepted 2019-MAY-02 AT 14:37 BST AT 14:37 BST by PPORRAS Frontiers in molecular neuroscience 2017 Only protein-protein interactions imex curation imex curation Corrected: LRRK2 expressed in E.coli.; DNM1 exp. prep.; ser-616 feature role as observed ptm.; Corrected: Strep tag; data-processing added at publication level; Exp preps in LRRK2 in EBI-21224908 added; data-processing comment removed; Strep tag feature corrected; pSer position corrected and feature role added; G2019S mutation effect corrected; Feature updated: strep-flag tandem tag; Data-processing comment corrected; 1-912 captured as 'required to bind' and 913-2527 sufficient to bind feature deleted; strep-flag tag feature updated The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. Frontiers in molecular neuroscience 2017 imex curation Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it Accepted 2019-MAY-02 AT 14:37 BST AT 14:37 BST by PPORRAS Frontiers in molecular neuroscience 2017 Only protein-protein interactions imex curation imex curation Corrected: LRRK2 expressed in E.coli.; DNM1 exp. prep.; ser-616 feature role as observed ptm.; Corrected: Strep tag; data-processing added at publication level; Exp preps in LRRK2 in EBI-21224908 added; data-processing comment removed; Strep tag feature corrected; pSer position corrected and feature role added; G2019S mutation effect corrected; Feature updated: strep-flag tandem tag; Data-processing comment corrected; 1-912 captured as 'required to bind' and 913-2527 sufficient to bind feature deleted; strep-flag tag feature updated The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. Frontiers in molecular neuroscience 2017 imex curation Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay anti tag western anti tag western blot anti tag western Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it Accepted 2019-MAY-02 AT 14:37 BST AT 14:37 BST by PPORRAS Frontiers in molecular neuroscience 2017 Only protein-protein interactions imex curation imex curation Corrected: LRRK2 expressed in E.coli.; DNM1 exp. prep.; ser-616 feature role as observed ptm.; Corrected: Strep tag; data-processing added at publication level; Exp preps in LRRK2 in EBI-21224908 added; data-processing comment removed; Strep tag feature corrected; pSer position corrected and feature role added; G2019S mutation effect corrected; Feature updated: strep-flag tandem tag; Data-processing comment corrected; 1-912 captured as 'required to bind' and 913-2527 sufficient to bind feature deleted; strep-flag tag feature updated The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. The LRRK2 Variant E193K Prevents Mitochondrial Fission Upon MPP+ Treatment by Altering LRRK2 Binding to DRP1. Frontiers in molecular neuroscience 2017 imex curation Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Perez Carrion M., Pischedda F., Biosa A., Russo I., Straniero L., Civiero L., Guida M., Gloeckner CJ., Ticozzi N., Tiloca C., Mariani C., Pezzoli G., Duga S., Pichler I., Pan L., Landers JE., Greggio E., Hess MW., Goldwurm S., Piccoli G. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease Origin of species of Rab8 and Mitofusion-2 are unavailable within the reference, so experimental results of figure 2g, & suppl. figure 1c has not been captured; the authors have been contacted via mail in this regard. stefano.goldwurm@gmail.com,giovanni.piccoli@unitn.it Accepted 2019-MAY-02 AT 14:37 BST AT 14:37 BST by PPORRAS Frontiers in molecular neuroscience 2017 Only protein-protein interactions imex curation imex curation Corrected: LRRK2 expressed in E.coli.; DNM1 exp. prep.; ser-616 feature role as observed ptm.; Corrected: Strep tag; data-processing added at publication level; Exp preps in LRRK2 in EBI-21224908 added; data-processing comment removed; Strep tag feature corrected; pSer position corrected and feature role added; G2019S mutation effect corrected; Feature updated: strep-flag tandem tag; Data-processing comment corrected; 1-912 captured as 'required to bind' and 913-2527 sufficient to bind feature deleted; strep-flag tag feature updated dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 F9521A376B785B71 lrrk2_mouse Leucine-rich repeat serine/threonine-protein kinase 2 Lrrk2 protein protein mouse Mus musculus Mouse MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFLLIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKEIVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTLGNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPGLLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKESSPKLVELLLNGGCREQDVRKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRCSPNAQRHSNSLGPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASEREHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLIHLDLHSNKFTSFPSFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE DIP protein Q5S006 original sequence version: 57 706E25C173E36F98 dnm1l_mouse Dynamin-1-like protein Dnm1l Drp1 Dynamin-related protein 1 Dynamin family member proline-rich carboxyl-terminal domain less protein protein mouse Mus musculus Mouse MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKSSKVPSALAPASQEPPPAASAEADGKLIQDNRRETKNVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW 5A8679B61A444847 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 lrrk2-39 2 11 unspecified role unspecified role putative self putative self over-expressed over expressed level over-expressed purified purified strep-flag tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 33p radiolabel 33p radiolabel P33 33P undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q5S007:p.Glu193Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 19:07:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu193Lys' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation true Figure 2b lrrk2-50 5 11 unspecified role unspecified role putative self putative self over-expressed over expressed level over-expressed purified purified Q5S007:p.Glu193Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 17:13:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu193Lys' Q5S007:p.Gly2019Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G S Tue Jun 30 18:16:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly2019Ser' strep-flag tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ser-935 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm thr-2483 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation true Figure 2d, 2e, 2f, Supplementary figure 1a lrrk2-ywhah-1 3 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q5S007:p.Glu193Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 18:17:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu193Lys' physical association physical association Figure 3d dnm1l-lrrk2-2 4 9 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 7a denr-lrrk2-2 6 7 unspecified role unspecified role prey prey living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain The interaction with DRP1 was severely reduced in the LRRK2 913-2527 variant strep-flag tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 7b denr-lrrk2-3 1 7 unspecified role unspecified role prey prey cell lysate cell lysate expression modif expression level alteration expression modif region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser-616 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified Q5S007:p.Glu193Lys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 17:09:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu193Lys' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 7c dnm1l-lrrk2-4 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell strep-flag tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Glu193Lys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 16:11:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu193Lys' physical association physical association Figure 7e