IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ C-reactive protein and pentraxin-3 binding of factor H-like protein 1 differs from complement factor H: implications for retinal inflammation. C-reactive protein and pentraxin-3 binding of factor H-like protein 1 differs from complement factor H: implications for retinal inflammation. Scientific reports 2018 imex curation Swinkels M., Zhang JH., Tilakaratna V., Black G., Perveen R., McHarg S., Inforzato A., Day AJ., Clark SJ. Details of FHL-1 expression were obtained from PMID:21146613. No details for CCP67 (402Y/402H ± tail) expression could be found. anthony.day@manchester.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Swinkels M., Zhang JH., Tilakaratna V., Black G., Perveen R., McHarg S., Inforzato A., Day AJ., Clark SJ. Details of FHL-1 expression were obtained from PMID:21146613. No details for CCP67 (402Y/402H ± tail) expression could be found. anthony.day@manchester.ac.uk Accepted 2020-MAR-03 AT 12:17 GMT AT 12:17 GMT by ORCHARD Scientific reports 2018 Only protein-protein interactions imex curation imex curation cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS 09BCE02E2A62D62A p08603-2 Complement factor H CFH HF HF1 HF2 FHL-1 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL C2AAD47F155343E3 p08603-pro_0000005894 Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR 19 1231 AFED24274C007CFF crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 crp-cfh-22 1 5 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 1B crp-cfh-23 1 2 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 16:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 1C crp-cfh-24 1 2 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-8 sufficient to bind sufficient binding region sufficient to bind range range range range n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P08603:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 18:16:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 1D crp-cfh-25 1 4 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:46:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 1E crp-cfh-26 1 4 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 16:42:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 1F crp-cfh-27 1 4 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-7 sufficient to bind sufficient binding region sufficient to bind range range range range P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:05:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 2A/C The FHL-1 tail [aas 446-449] had a positive influence on the binding of the 402Y form of CCP67 to mCRP (Fig. 2A) crp-cfh-28 1 4 unspecified role unspecified role prey prey purified purified SCR/Sushi_domains 6-7 sufficient to bind sufficient binding region sufficient to bind range range range range P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:40:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 2 B/D No effect of the tail [aas 446-449] on the binding of the 402 H form of CCP67 to either mCRP or pCRP was observed. crp-cfh-29 1 5 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma 3 unspecified role unspecified role prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 direct interaction direct interaction 3A cfh-ptx3-6 1 4 unspecified role unspecified role bait bait purified purified P08603-2:p.Tyr402His mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 15:59:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 3 unspecified role unspecified role prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 direct interaction direct interaction 3B crp-cfh-30 1 4 unspecified role unspecified role bait bait purified purified SCR/Sushi_domains 6-7 sufficient to bind sufficient binding region sufficient to bind range range range range P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 18:02:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' 3 unspecified role unspecified role prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 direct interaction direct interaction 3 C/D The C-terminal tail of FHL-1 [aas 446-449] was found to make a significant contribution to the interaction with PTX3 in the context of both the 402Y and 402H variants. crp-cfh-31 1 4 competitor competitor competitor prey prey picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 5 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma physical association physical association Supp. fig 2 crp-cfh-32 1 4 unspecified role unspecified role prey prey purified purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 3 competitor competitor competitor prey prey purified purified human-perc6 Perc6 human embryonic retinal cells perc6 PerC6 human embryonic retinal cells CVCL_G704 6 unspecified role unspecified role bait bait purified purified human-plasma homo sapiens blood plasma plasma blood plasma physical association physical association Supp. fig 4