DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryo-EM structures of the human INO80 chromatin-remodeling complex. Cryo-EM structures of the human INO80 chromatin-remodeling complex. Nature structural & molecular biology 2018 imex curation Aramayo RJ., Willhoft O., Ayala R., Bythell-Douglas R., Wigley DB., Zhang X. xiaodong.zhang@imperial.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Aramayo RJ., Willhoft O., Ayala R., Bythell-Douglas R., Wigley DB., Zhang X. xiaodong.zhang@imperial.ac.uk Accepted 2020-MAR-26 AT 11:26 GMT AT 11:26 GMT by ORCHARD Nature structural & molecular biology 2018 imex curation ruvb2_human RuvB-like 2 RUVBL2 TIP48 TIP49B CGI-46 48 kDa TATA box-binding protein-interacting protein TIP49b Repressing pontin 52 51 kDa erythrocyte cytosolic protein INO80J TIP60-associated protein 54-beta INO80 complex subunit J protein protein human Homo sapiens Human MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS DIP protein Q9Y230 original sequence version: 92 DIP protein Q9Y230 original sequence version: 120 DIP protein Q9Y230 original sequence version: 142 DIP protein Q9Y230 original sequence version: 180 54C78E9C587D975A ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK DIP protein Q9Y265 original sequence version: 82 DIP protein Q9Y265 original sequence version: 110 6095ADE692B1482B ruvbl1-ruvbl2-10 1 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig 1, Table 1, Supplementary Fig 1, 2