UniProt UniProt http://www.uniprot.org Vectors for Expression of Signal Peptide-Dependent Proteins in Baculovirus/Insect Cell Systems and Their Application to Expression and Purification of the High-Affinity Immunoglobulin Gamma Fc Receptor I in Complex with Its Gamma Chain. Vectors for Expression of Signal Peptide-Dependent Proteins in Baculovirus/Insect Cell Systems and Their Application to Expression and Purification of the High-Affinity Immunoglobulin Gamma Fc Receptor I in Complex with Its Gamma Chain. Molecular biotechnology 2018 imex curation Le LTM., Nyengaard JR., Golas MM., Sander B. Data relating to IgG2A could not be captured as this is a purified complex and will consist of a mixture of different heavy and light chains. bsander@clin.au.dk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Le LTM., Nyengaard JR., Golas MM., Sander B. Data relating to IgG2A could not be captured as this is a purified complex and will consist of a mixture of different heavy and light chains. bsander@clin.au.dk Accepted 2019-JUN-04 AT 16:18 BST AT 16:18 BST by MGT Molecular biotechnology 2018 Only protein-protein interactions imex curation imex curation Vectors for Expression of Signal Peptide-Dependent Proteins in Baculovirus/Insect Cell Systems and Their Application to Expression and Purification of the High-Affinity Immunoglobulin Gamma Fc Receptor I in Complex with Its Gamma Chain. Vectors for Expression of Signal Peptide-Dependent Proteins in Baculovirus/Insect Cell Systems and Their Application to Expression and Purification of the High-Affinity Immunoglobulin Gamma Fc Receptor I in Complex with Its Gamma Chain. Molecular biotechnology 2018 imex curation Le LTM., Nyengaard JR., Golas MM., Sander B. Data relating to IgG2A could not be captured as this is a purified complex and will consist of a mixture of different heavy and light chains. bsander@clin.au.dk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down anti tag western anti tag western blot anti tag western Le LTM., Nyengaard JR., Golas MM., Sander B. I have a copy of the paper if needed. Data relating to IgG2A could not be captured as this is a purified complex and will consist of a mixture of different heavy and light chains. bsander@clin.au.dk Accepted 2019-JUN-04 AT 16:18 BST AT 16:18 BST by MGT Molecular biotechnology 2018 Only protein-protein interactions imex curation imex curation fcgr1_human High affinity immunoglobulin gamma Fc receptor I FCGR1A FCG1 FCGR1 IGFR1 Fc-gamma RI Fc-gamma RIA protein protein human Homo sapiens Human MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT D33D59398CEEA699 fcerg_human High affinity immunoglobulin epsilon receptor subunit gamma IgE Fc receptor subunit gamma Fc-epsilon RI-gamma FCER1G Fc receptor gamma-chain protein protein human Homo sapiens Human MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ DIP protein P30273 original sequence version: 64 2F2C7536513D6165 fcer1g-fcgr1a-1 2 4 unspecified role unspecified role prey prey partially purified partially purified 3 unspecified role unspecified role bait bait partially purified partially purified c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P12314:p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195Thr;Leu207Pro;Asn240Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain T P certain certain sequence position certain certain certain sequence position certain T S certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain T I certain certain sequence position certain certain certain sequence position certain S T certain certain sequence position certain certain certain sequence position certain N D certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain I M certain certain sequence position certain certain certain sequence position certain N S certain certain sequence position certain certain certain sequence position certain N T certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain N D Fri Feb 01 16:46:44 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195The;Leu207Pro;Asn240Asp]' Tue Jun 30 17:30:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195Thr;Leu207Pro;Asn240Asp]' direct interaction direct interaction Fig. 3B Upon affinity purification of CD64, CD64 co-eluted together with the γ-chain (Fig. 3b, bottom). fcgr1a-fcer1g-1 1 4 unspecified role unspecified role neutral component neutral component partially purified partially purified 3 unspecified role unspecified role neutral component neutral component partially purified partially purified c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P12314:p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195Thr;Leu207Pro;Asn240Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain T P certain certain sequence position certain certain certain sequence position certain T S certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain T I certain certain sequence position certain certain certain sequence position certain S T certain certain sequence position certain certain certain sequence position certain N D certain certain sequence position certain certain certain sequence position certain I V certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain I M certain certain sequence position certain certain certain sequence position certain N S certain certain sequence position certain certain certain sequence position certain N T certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain N D Fri Feb 01 16:02:23 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195The;Leu207Pro;Asn240Asp]' Tue Jun 30 20:03:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195Thr;Leu207Pro;Asn240Asp]' direct interaction direct interaction Fig. 4