UniProt UniProt http://www.uniprot.org Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-microglia Mouse micoglia microglia microglia pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Primary microglia cultures from the hippocampus of two-day-old non-transgenic control and APP Sw,Ind mice. (APP Sw,Ind transgenic mice express human APP695 harboring the FAD-linked Swedish (K670 N/M671 L) and Indiana (V717 F) mutations.) rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-microglia Mouse micoglia microglia microglia confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Microglia from mouse striatum. rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n9 mouse n9 cell line Mouse n9 cell n-9 cell Murine microglial cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n9 mouse n9 cell line Mouse n9 cell n-9 cell Murine microglial cell line confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-microglia Mouse micoglia microglia microglia pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Primary cultures of microglia from mouse striatum. rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer's disease and levodopa-induced dyskinesia. Brain, behavior, and immunity 2018 imex curation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease rfranco@ub.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n9 mouse n9 cell line Mouse n9 cell n-9 cell Murine microglial cell line bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Navarro G., Borroto-Escuela D., Angelats E., Etayo Í., Reyes-Resina I., Pulido-Salgado M., Rodríguez-Pérez AI., Canela EI., Saura J., Lanciego JL., Labandeira-García JL., Saura CA., Fuxe K., Franco R. Parkinsons - Interactions investigated in the context of Parkinsons disease rfranco@ub.edu Accepted 2019-OCT-31 AT 14:08 GMT AT 14:08 GMT by MGT Brain, behavior, and immunity 2018 Only protein-protein interactions imex curation imex curation cnr2_rat Cannabinoid receptor 2 Cnr2 protein protein rat Rattus norvegicus (Rat) Rat MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILSSQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLDVRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYALRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC E523C77055B24BE0 cnr1_rat Cannabinoid receptor 1 Cnr1 Skr6 Brain-type cannabinoid receptor protein protein rat Rattus norvegicus (Rat) Rat MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL E59A66AFE17B646C cnr2_human Cannabinoid receptor 2 CNR2 CX5 CB2A CB2B protein protein human Homo sapiens Human MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC A7ECF68C16E7514B cnr1_mouse Cannabinoid receptor 1 Cnr1 Brain-type cannabinoid receptor protein protein mouse Mus musculus Mouse MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL E504168191CB6429 cnr2_mouse Cannabinoid receptor 2 Cnr2 protein protein mouse Mus musculus Mouse MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILSSRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLDVRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYALRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT 10747611D41FF442 cnr1_human Cannabinoid receptor 1 CNR1 CNR CANN6 protein protein human Homo sapiens Human MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL DIP protein P21554 original sequence version: 162 1D2E49061D12ABF2 cnr1-cnr2-2 7 10 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed c-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 1A LPS (CHEBI:89983) + IFNG (P01579) cnr1-cnr2-3 5 10 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminus eyfp enhanced yellow fluorescent protein tag eyfp c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 1D LPS (CHEBI:89983) + IFNG (P01579) cnr1-cnr2-4 4 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 1E LPS (CHEBI:89983) + IFNG (P01579) cnr1-cnr2-5 6 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 2D LPS (CHEBI:89983) + IFNG (P01579) cnr1-cnr2-6 3 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 2C LPS (CHEBI:89983) + IFNG (P01579) cnr1-cnr2-7 1 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 5 In a rat model of Parkinson's Disease, lesioned animals displayed a significant increase in the level of CB1-CB2 receptor complexes in the striatum. cnr1-cnr2-8 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 6A Far more cells were stained, and a greater number of red dots/cell were seen in the APP Sw,Ind transgenic animals as compared to control.