IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Molecular neurobiology 2018 imex curation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. Accepted 2019-AUG-01 AT 10:03 BST AT 10:03 BST by ORCHARD Molecular neurobiology 2018 imex curation Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Molecular neurobiology 2018 imex curation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. Accepted 2019-AUG-01 AT 10:03 BST AT 10:03 BST by ORCHARD Molecular neurobiology 2018 imex curation Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Molecular neurobiology 2018 imex curation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence fluorescence technology fluorescence tag visualisation tag visualisation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. SRET:Sequential BRET-FRET;BRET combined with FRET. Oxidation of a Renilla Luciferase substrate triggers acceptor excitation by BRET and subsequent energy transfer to a FRET acceptor, with OX 1-YFP being the final fluorescence acceptor. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. Accepted 2019-AUG-01 AT 10:03 BST AT 10:03 BST by ORCHARD Molecular neurobiology 2018 imex curation Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Molecular neurobiology 2018 imex curation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. Accepted 2019-AUG-01 AT 10:03 BST AT 10:03 BST by ORCHARD Molecular neurobiology 2018 imex curation Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Orexin A/Hypocretin Modulates Leptin Receptor-Mediated Signaling by Allosteric Modulations Mediated by the Ghrelin GHS-R1A Receptor in Hypothalamic Neurons. Molecular neurobiology 2018 imex curation Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Medrano M., Aguinaga D., Reyes-Resina I., Canela EI., Mallol J., Navarro G., Franco R. not to go through to checking until new cv terms are available for roles for SRET experiment. (date 12/1/19/) see pmid:28734930. 17/7/19 Pablo said to use the "luminescence acceptor-donor pair " term for SRET. 18/7 told new term was being invented, so please wait to check - will alter when new term available in CVs. Bifc combined with Confocal Microscopy/Immunostaining. rfranco@ub.edu,rfranco123@gmail.com,g.navarro@ub.edu not all stated email addresses are current. Accepted 2019-AUG-01 AT 10:03 BST AT 10:03 BST by ORCHARD Molecular neurobiology 2018 imex curation lepr_human Leptin receptor OB receptor HuB219 LEPR DB OBR protein protein human Homo sapiens Human MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGSFQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPPLGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTVIREADKIVSATSLLVDSILPGSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSIGASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYFIIEWKNLNEDGEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDAGLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIKHTASVTCGPLLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTYEDESQRQPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPLKDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDKKSIYYLGVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSCSHFVENNINLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV DIP protein P48357 original sequence version: 151 DIP protein P48357 original sequence version: 96 DIP protein P48357 original sequence version: 135 CAA03BEAF2602D0A ox1r_human Orexin/Hypocretin receptor type 1 Hypocretin receptor type 1 HCRTR1 Orexin receptor type 1 protein protein human Homo sapiens Human MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP B650B37F3A2CA096 q92847-1 Growth hormone secretagogue receptor type 1 GH-releasing peptide receptor Ghrelin receptor GHSR protein protein human Homo sapiens Human MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSINT D1B62710DA9DC0C6 ghsr-lepr-1 4 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 anti tag immunost anti tag immunostaining anti tag immunost tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 1A ghsr-lepr-2 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B ghsr-lepr-3 1 6 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1C ghsr-hcrtr1-2 4 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 anti tag immunost anti tag immunostaining anti tag immunost tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 2A ghsr-hcrtr1-4 1 7 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2C ghsr-hcrtr1-3 2 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2B hcrtr1-lepr-2 4 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 anti tag immunost anti tag immunostaining anti tag immunost tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 3A hcrtr1-lepr-3 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3B hcrtr1-lepr-1 5 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 anti tag immunost anti tag immunostaining anti tag immunost tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 anti tag immunost anti tag immunostaining anti tag immunost tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4B GHS-R1a-cYFP and OX 1 -nYFP interact to give YFP fluorescence; Leptin receptor was detected by anti-Luc antibody . ghsr-hcrtr1-1 3 8 unspecified role unspecified role luminescence transmitter luminescence transmitter over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 anti tag immunost anti tag immunostaining anti tag immunost tag visualisation tag visualisation unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 anti tag immunost anti tag immunostaining anti tag immunost tag visualisation tag visualisation unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4C