IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heterodimers of serotonin receptor subtypes 2 are driven by 5-HT2C protomers. Heterodimers of serotonin receptor subtypes 2 are driven by 5-HT2C protomers. The Journal of biological chemistry 2017 imex curation Moutkine I., Quentin E., Guiard BP., Maroteaux L., Doly S. The 5-HT2C_INI receptor isoform used in this publication has no RNA editing at positions 156, 158 and 160 so has the residues "INI" in these locations. Luc.maroteaux@upmc.fr,stephane.doly@inserm.fr 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Moutkine I., Quentin E., Guiard BP., Maroteaux L., Doly S. The 5-HT2C_INI receptor isoform used in this publication has no RNA editing at positions 156, 158 and 160 so has the residues "INI" in these locations. Luc.maroteaux@upmc.fr,stephane.doly@inserm.fr Accepted 2019-MAY-23 AT 08:39 BST AT 08:39 BST by LIVIAP The Journal of biological chemistry 2017 Only protein-protein interactions imex curation imex curation roles altered, but for EBI-21396054 what you are suggesting is already shown?? Heterodimers of serotonin receptor subtypes 2 are driven by 5-HT2C protomers. Heterodimers of serotonin receptor subtypes 2 are driven by 5-HT2C protomers. The Journal of biological chemistry 2017 imex curation Moutkine I., Quentin E., Guiard BP., Maroteaux L., Doly S. The 5-HT2C_INI receptor isoform used in this publication has no RNA editing at positions 156, 158 and 160 so has the residues "INI" in these locations. Luc.maroteaux@upmc.fr,stephane.doly@inserm.fr 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Moutkine I., Quentin E., Guiard BP., Maroteaux L., Doly S. The 5-HT2C_INI receptor isoform used in this publication has no RNA editing at positions 156, 158 and 160 so has the residues "INI" in these locations. Luc.maroteaux@upmc.fr,stephane.doly@inserm.fr Accepted 2019-MAY-23 AT 08:39 BST AT 08:39 BST by LIVIAP The Journal of biological chemistry 2017 Only protein-protein interactions imex curation imex curation roles altered, but for EBI-21396054 what you are suggesting is already shown?? 5ht2a_human 5-hydroxytryptamine receptor 2A HTR2A HTR2 Serotonin receptor 2A protein protein human Homo sapiens Human MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV EF8AAC0BC5379DA2 5ht2b_human 5-hydroxytryptamine receptor 2B HTR2B Serotonin receptor 2B protein protein human Homo sapiens Human MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV mint This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system CDA4447ECDBA3B46 5ht2c_human 5-hydroxytryptamine receptor 2C 5-hydroxytryptamine receptor 1C Serotonin receptor 2C HTR2C HTR1C protein protein human Homo sapiens Human MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV 9E76B3FFD3E09C93 htr2a-htr2a-1 1 3 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1A-1 htr2b-htr2b-1 1 4 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed yfp_or_RLuc tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed yfp_or_RLuc tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B-2 if you can work out which way around the tags are, let me know and I will alter. htr2c-htr2c-1 1 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1A-3 htr2a-htr2b-1 1 5 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed yfp_or_RLuc tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed yfp_or_RLuc tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B-1 if you can work out which way around the tags are, let me know and I will alter. (the first of a pair is probably RLuc tagged, but this is not stated for figure 1.) htr2a-htr2c-7 1 4 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed yfp_or_RLuc tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed yfp_or_RLuc tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 1B-3 if you can work out which way around the tags are, let me know and I will alter. htr2c-htr2a-1 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 1C-3 htr2c-htr2c-2 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 1C-1 htr2c-htr2a-2 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 1C-4 htr2b-htr2a-1 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 1C-2 htr2a-htr2c-8 1 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 7A htr2a-htr2c-9 1 4 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain proximity proximity close-contact colocalization neighbourhood interaction Figure 7B htr2a-htr2c-10 1 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 7D htr2b-htr2c-1 1 4 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed C-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 7C