IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Biochemistry 2017 imex curation Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro aggregation aggregation assay aggregation predetermined predetermined participant predetermined Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. I have added all mutations here as affecting "rate" rather than strength as they are measuring w.r.t time, except for second interaction when some entered as "mutation". There could have been entered a lot more interactions here (for fig 1);but I have just entered a comment as I do not think more interactions would have added clarity. Fibril formation was monitored using a continuous thioflavin T assay. When ThT binds to beta sheet-rich structures, such as those in amyloid aggregates, the dye displays enhanced fluorescence and a characteristic red shift of its emission spectrum. Binding induces a shift in excitation maximum (385 nm to 450 nm) and emission maximum (445 nm to 482 nm). Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au Accepted 2020-MAR-03 AT 09:05 GMT AT 09:05 GMT by LIVIAP Biochemistry 2017 Only protein-protein interactions imex curation imex curation Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Biochemistry 2017 imex curation Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro aut-page aut-page predetermined predetermined participant predetermined Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Samples were mixed and incubated under fibril forming conditions, centrifuged, and the supernatant and pellet fractions for each sample were loaded onto an acetic acid-urea PAGE gel for analysis; this method separates apoC-II derivatives based on their net charge at pH 3. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au Accepted 2020-MAR-03 AT 09:05 GMT AT 09:05 GMT by LIVIAP Biochemistry 2017 Only protein-protein interactions imex curation imex curation Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Biochemistry 2017 imex curation Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro aggregation aggregation assay aggregation ms participant Identification by mass spectrometry ms participant Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Pellet fractions of the hybrid fibrils were further analyzed by mass spectrometry to detect the presence of each apoC-II variant by their corresponding mass. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au Accepted 2020-MAR-03 AT 09:05 GMT AT 09:05 GMT by LIVIAP Biochemistry 2017 Only protein-protein interactions imex curation imex curation Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Intra- and Intersubunit Ion-Pair Interactions Determine the Ability of Apolipoprotein C-II Mutants To Form Hybrid Amyloid Fibrils. Biochemistry 2017 imex curation Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Todorova N., Zlatic CO., Mao Y., Yarovsky I., Howlett GJ., Gooley PR., Griffin MD. Samples stained with potassium phosphotungstate. Human apolipoprotein C-II was found to have a Uniprot identifier of PRO_0000002024 by mutation mapping. mgriffin@unimelb.edu.au Accepted 2020-MAR-03 AT 09:05 GMT AT 09:05 GMT by LIVIAP Biochemistry 2017 Only protein-protein interactions imex curation imex curation p02655-pro_0000002024 Proapolipoprotein C-II Apolipoprotein C2 APOC2 APC2 protein protein human Homo sapiens Human TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE 23 101 5C19D7D724CE02E0 apoc2-apoc2-4 4 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 15:54:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A WT+K30D apoc2-apoc2-5 4 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 17:09:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 19:00:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B KDDK+K30D apoc2-apoc2-6 4 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 20:15:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:44:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C D69K+K30D apoc2-apoc2-7 2 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 19:23:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 16:24:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3-3 D69K+K30D apoc2-apoc2-8 2 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:04:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3-2 WT+K30D apoc2-apoc2-9 2 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 15:52:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' P02655-PRO_0000002024:p.Asp69Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 15:45:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 19:30:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:24:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' P02655-PRO_0000002024:p.Asp69Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 18:18:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 18:43:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3-1 WT, D69K, and KDDK apoC-II show little protein in the supernatant fraction, and a distinct band in the pellet fraction, indicating that the majority of protein was incorporated into fibrils. ApoC-II variant K30D shows a strong band in the supernatant fraction and little protein in the pellet fraction, confirming that K30D apoC-II does not form fibrils. apoc2-apoc2-10 2 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 17:21:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 16:16:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3-4 KDDK+K30D apoc2-apoc2-11 3 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:54:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A WT+K30D apoc2-apoc2-12 3 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 20:18:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 19:57:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B D69K+K30D apoc2-apoc2-14 3 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 18:33:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation mutation certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 20:09:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 4C KDDK+K30D apoc2-apoc2-13 1 5 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 19:22:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) 59 61 direct interaction direct interaction 5A Each sample showed a time-dependent increase in ThT fluorescence indicating incorporation of monomer into the preformed fibrils. Samples of preformed fibrils with added identical variant had a greater rate of change in ThT fluorescence compared to samples of preformed fibril with added K30D apoC-II variant. apoc2-apoc2-15 1 5 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 16:26:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 19:06:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 15:56:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 16:55:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) 69 66 direct interaction direct interaction 5B Each sample showed a time-dependent increase in ThT fluorescence indicating incorporation of monomer into the preformed fibrils. Samples of preformed fibrils with added identical variant had a greater rate of change in ThT fluorescence compared to samples of preformed fibril with added K30D apoC-II variant. apoc2-apoc2-16 1 5 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 15:57:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain D K certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 19:59:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 17:04:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain D K certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:40:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 79 76 direct interaction direct interaction 5C Each sample showed a time-dependent increase in ThT fluorescence indicating incorporation of monomer into the preformed fibrils. Samples of preformed fibrils with added identical variant had a greater rate of change in ThT fluorescence compared to samples of preformed fibril with added K30D apoC-II variant. apoc2-apoc2-17 1 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:42:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A Equimolar mixtures of K30D apoC-II with WT, D69K or KDDK all showed a time- dependent increase in ThT fluorescence suggesting successful fibril formation. The maximum change in ThT fluorescence of these mixtures was higher than that of fibrils formed by WT, D69K or KDDK alone. apoc2-apoc2-18 1 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 18:10:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Asp69Lys mutation mutation certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 16:36:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp69Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 18:59:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B Equimolar mixtures of K30D apoC-II with WT, D69K or KDDK all showed a time- dependent increase in ThT fluorescence suggesting successful fibril formation. The maximum change in ThT fluorescence of these mixtures was higher than that of fibrils formed by WT, D69K or KDDK alone. apoc2-apoc2-19 1 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 20:21:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.[Lys30Asp;Asp69Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 17:00:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys30Asp;Asp69Lys]' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified P02655-PRO_0000002024:p.Lys30Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K D Tue Jun 30 16:39:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys30Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C Equimolar mixtures of K30D apoC-II with WT, D69K or KDDK all showed a time- dependent increase in ThT fluorescence suggesting successful fibril formation. The maximum change in ThT fluorescence of these mixtures was higher than that of fibrils formed by WT, D69K or KDDK alone.