IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Journal of neuroinflammation 2017 imex curation Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. famas2367@gmx.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom antibody detection identification by antibody antibody detection Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. I cannot find where the Heparin came from/expressed in. -not "chemical syn" although chemically modified to bind to sepharose. The heparan -Sulphate was the only one found when searching for Sigma as a supplier. Participant Detection by Flow Cytometry. famas2367@gmx.de Accepted 2019-OCT-28 AT 14:31 GMT AT 14:31 GMT by PPORRAS Journal of neuroinflammation 2017 Only protein-protein interactions imex curation imex curation Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Journal of neuroinflammation 2017 imex curation Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. famas2367@gmx.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. famas2367@gmx.de Accepted 2019-OCT-28 AT 14:31 GMT AT 14:31 GMT by PPORRAS Journal of neuroinflammation 2017 Only protein-protein interactions imex curation imex curation Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Journal of neuroinflammation 2017 imex curation Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. famas2367@gmx.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. dear checker; please ensure the Exp-Mod makes sense, as what i am seeing there varies each time I look. I have added 2 interactiions - one for purified properdin, one for "physiological". Binding of properdin either purified, or derived from complement active and inactive human serum , to ARMS2 coated CHO-K1 cells. famas2367@gmx.de Accepted 2019-OCT-28 AT 14:31 GMT AT 14:31 GMT by PPORRAS Journal of neuroinflammation 2017 Only protein-protein interactions imex curation imex curation Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Journal of neuroinflammation 2017 imex curation Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. famas2367@gmx.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. CHO-K1 cells were incubated with ARMS2 and properdin. famas2367@gmx.de Accepted 2019-OCT-28 AT 14:31 GMT AT 14:31 GMT by PPORRAS Journal of neuroinflammation 2017 Only protein-protein interactions imex curation imex curation Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Age-related macular degeneration associated polymorphism rs10490924 in ARMS2 results in deficiency of a complement activator. Journal of neuroinflammation 2017 imex curation Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. famas2367@gmx.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Micklisch S., Lin Y., Jacob S., Karlstetter M., Dannhausen K., Dasari P., von der Heide M., Dahse HM., Schmölz L., Grassmann F., Alene M., Fauser S., Neumann H., Lorkowski S., Pauly D., Weber BH., Joussen AM., Langmann T., Zipfel PF., Skerka C. C3b is a complex composed of the modified C3-alpha chain (a') (M.W. 105,000) and the intact C3-beta chain (M.W. 75,000). Factor I cleaves the a' chain of the C3b complex. famas2367@gmx.de Accepted 2019-OCT-28 AT 14:31 GMT AT 14:31 GMT by PPORRAS Journal of neuroinflammation 2017 Only protein-protein interactions imex curation imex curation prop_human Properdin CFP PFC Complement factor P protein protein human Homo sapiens Human MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL 5EB42B63F0283917 heparan_sulfate Heparan_Sulfate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) arms2_human Age-related maculopathy susceptibility protein 2 ARMS2 protein protein human Homo sapiens Human MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR 2F8D3812B5DDF55F p01024-pro_0000005908 Complement C3 beta chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAA 23 667 C4754001F1A97259 heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p01024-pro_0000005911 Complement C3b alpha' chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN 749 1663 1E32EA0CEA20EA81 heparin-arms2-1 2 9 unspecified role unspecified role prey prey purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 11 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3E heparin-arms2-2 2 9 unspecified role unspecified role prey prey purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 11 unspecified role unspecified role bait bait purified purified 8 competitor competitor competitor unspecified role unspecified role purified purified bovin-kidney bovin kidney kidney kidney [Renal] physical association physical association 3E 567rt-1 6 9 unspecified role unspecified role prey prey purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role bait bait purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction 5A cfp-arms2-1 6 9 unspecified role unspecified role bait bait purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction 5 B/E arms2-cfp-1 6 37 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 9 unspecified role unspecified role bait bait purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role ancillary ancillary purified purified human-serum Homo sapiens serum Serum physical association physical association 5C C3b bound to the immobilized ARMS2-properdin complex arms2-cfp-2 3 9 unspecified role unspecified role bait bait purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction 5D arms2-cfp-3 5 9 unspecified role unspecified role neutral component neutral component purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role neutral component neutral component purified purified human-serum Homo sapiens serum Serum colocalization colocalization 6A arms2-cfp-4 5 9 unspecified role unspecified role neutral component neutral component purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role neutral component neutral component conditioned medium conditioned medium human-neutrophil Homo sapiens polymorphonuclear neutrophil neutrophil Neutrophil [Neutrophilic granulocyte] colocalization colocalization 6B arms2-cfp-5 4 9 unspecified role unspecified role neutral component neutral component purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role neutral component neutral component purified purified human-serum Homo sapiens serum Serum physical association physical association 6C ARMS2 coated cells bound purified properdin. arms2-cfp-6 4 9 unspecified role unspecified role neutral component neutral component purified purified C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 6C-2 ARMS2 coated cells bound properdin from serum treated with EGTA and EDTA. c3b_human Complement C3b complex C3b dimer 12 unspecified role unspecified role C3 beta chain binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role C3b alpha(prime) chain binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 68 70 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A protein complex of the alternative pathway of complement activation of the innate immune system. Complement C3 precurser is activated by cleavage into C3a and C3b by C3 convertases, either C4bC2a in the classical and lectin pathways or C3(H2O)Bb, C3bBb, C3bBbC3b, C3bBbP or C3bBbC3bP in the alternative pathway. C3b acts as an opsonin and interacts with glycoproteins and carbohydrates on pathogenic or apoptotic target cell surfaces through its reactive thioester moiety. Opsonization of target cells leads to enhanced phagocytosis, lysis of target cells via membrane attack complex (CPX-6159) assembly, clearance of antibody-antigen complexes and up-regulation of the adaptive response. Activation of C3b leads to an amplification cascade that generates more C3 convertase, deposits more C3b at the local site and switches C3 convertases to C5 convertases. To protect host cells from inadvertent complement activation the activation of C3b is tightly regulated by either disrupting the C3 convertases or aiding in the proteolytic degradation of C3b. Bacteria and viruses possess C3b proteases to evade the complement response. Lack of protection, due to familial mutations in the complement genes or the presence of autoantibodies against regulators has been linked to atypical hemolytic uremic syndrome (aHUS) and C3 glomerulopathies (C3G) in kidneys and age-related macular degeneration (AMD) in eyes. Conditions of chronic and acute inflammations, as in rheumatoid arthritis, strokes, and heart attacks, become aggravated by complement activation against the disturbed tissue. The alternative pathway is continuously activated at a low level. C3 precursor is first processed by the removal of 4 Arg residues and spontaneous hydrolysis due to the breakdown of the internal thioester bond forms C3(H2O) (disulfide bonded P01024-PRO_0000005909 & P01024-PRO_0000005908). C3(H2O) subsequently binds factor B that is cleaved by Factor D (P00746) into 2 fragments: CFBa and CFBb. CFBb, a serine protease, then combines with complement factor C3(H2O) or C3b to generate the C3 or C5 convertases. Proteolytic cleavage of C3 to C3b is accompanied by large conformational changes that result in the exposure of cryptic binding sites required for convertase assembly and regulation. This includes a significant movement of the thioester-bond-containing domain through which C3b attaches to target surfaces. Heterodimer Complement component 3 (C3) deficiency [Orphanet:280133]: a rare, autosomal recessive defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis. Atypical hemolytic-uremic syndrome with C3 anomaly [Orphanet:2134 & Orphanet:93575]: an autosomal dominant, atypical form of hemolytic-uremic syndrome (aHUS, a thrombotic microangiopathy) characterized by mechanical hemolytic anemia, thrombocytopenia, and renal dysfunction. Age-related macular degeneration [EFO:0001365]: age-related macular degeneration usually in older adults which results in a loss of vision in the center of the visual field (the macula lutea) because of damage to the retina. Manifests as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane. Occurs in dry and wet forms. Most common cause of irreversible vision loss in the developed world. Accepted 2017-JAN-19 by ORCHARD coronavirus