IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disease-causing mutations affecting surface residues of mitochondrial glutaryl-CoA dehydrogenase impair stability, heteromeric complex formation and mitochondria architecture. Disease-causing mutations affecting surface residues of mitochondrial glutaryl-CoA dehydrogenase impair stability, heteromeric complex formation and mitochondria architecture. Human molecular genetics 2017 imex curation Schmiesing J., Lohmöller B., Schweizer M., Tidow H., Gersting SW., Muntau AC., Braulke T., Mühlhausen C. muehlhausen@uke.de,braulke@uke.de 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag fluorescence tag visualisation by fluorescence tag fluorescence Schmiesing J., Lohmöller B., Schweizer M., Tidow H., Gersting SW., Muntau AC., Braulke T., Mühlhausen C. muehlhausen@uke.de,braulke@uke.de Accepted 2019-SEP-25 AT 14:00 BST AT 14:00 BST by PPORRAS Human molecular genetics 2017 Only protein-protein interactions imex curation imex curation gcdh_human Glutaryl-CoA dehydrogenase, mitochondrial GCDH protein protein human Homo sapiens Human MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK 415B8D510027BB63 odo2_human Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial DLST DLTS Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex E2K 2-oxoglutarate dehydrogenase complex component E2 protein protein human Homo sapiens Human MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL A30E8CC959106B8F etfb_human Electron transfer flavoprotein subunit beta ETFB FP585 protein protein human Homo sapiens Human MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 47E6EAEF50EB2C80 gcdh-gcdh-1 1 2 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell region renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q92947:p.Trp50Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain W C Tue Jun 30 18:12:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp50Cys' Q92947:p.Arg88Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 18:53:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Cys' Q92947:p.Glu90Lys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 15:55:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu90Lys' Q92947:p.Arg94Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R L Tue Jun 30 19:00:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg94Leu' Q92947:p.Tyr113His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:11:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr113His' Q92947:p.Cys115Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 17:15:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys115Tyr' Q92947:p.Gly101Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 20:10:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly101Arg' Q92947:p.Gly117Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 19:47:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly117Arg' Q92947:p.Ser119Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S L Tue Jun 30 17:18:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Leu' Q92947:p.Tyr155His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr155His' Q92947:p.Arg161Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 15:35:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg161Gln' Q92947:p.Pro217Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 16:12:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro217Leu' Q92947:p.Arg227Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 18:13:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg227Pro' Q92947:p.Gly244Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G C Tue Jun 30 18:04:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Cys' Q92947:p.Met263Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain M V Tue Jun 30 17:08:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Val' Q92947:p.Pro278Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P S Tue Jun 30 19:20:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro278Ser' Q92947:p.Arg355His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 18:32:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg355His' Q92947:p.Pro248Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 19:52:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro248Leu' 2 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure S7, S8, Table 2a, 2b etfb-gcdh-1 1 4 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell region renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q92947:p.Trp50Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain W C Tue Jun 30 18:54:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp50Cys' Q92947:p.Arg88Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 19:00:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Cys' Q92947:p.Glu90Lys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 15:59:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu90Lys' Q92947:p.Arg94Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R L Tue Jun 30 18:27:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg94Leu' Q92947:p.Tyr113His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:57:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr113His' Q92947:p.Cys115Tyr mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 18:58:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys115Tyr' Q92947:p.Gly101Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 16:26:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly101Arg' Q92947:p.Gly117Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 15:41:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly117Arg' Q92947:p.Ser119Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S L Tue Jun 30 19:05:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Leu' Q92947:p.Tyr155His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:11:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr155His' Q92947:p.Arg161Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 18:28:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg161Gln' Q92947:p.Pro217Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 17:50:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro217Leu' Q92947:p.Arg227Pro mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 18:23:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg227Pro' Q92947:p.Gly244Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G C Tue Jun 30 16:38:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Cys' Q92947:p.Met263Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain M V Tue Jun 30 19:04:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Val' Q92947:p.Pro278Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P S Tue Jun 30 18:35:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro278Ser' Q92947:p.Arg355His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 16:16:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg355His' Q92947:p.Pro248Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 18:21:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro248Leu' proximity proximity close-contact colocalization neighbourhood interaction Figure S9, S10, Table 2a, 2b dlst-gcdh-1 1 3 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell region renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q92947:p.Trp50Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain W C Tue Jun 30 16:52:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp50Cys' Q92947:p.Arg88Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 19:03:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Cys' Q92947:p.Glu90Lys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 17:12:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu90Lys' Q92947:p.Arg94Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R L Tue Jun 30 17:56:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg94Leu' Q92947:p.Tyr113His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 19:03:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr113His' Q92947:p.Cys115Tyr mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 18:41:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys115Tyr' Q92947:p.Gly101Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 18:46:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly101Arg' Q92947:p.Gly117Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 18:30:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly117Arg' Q92947:p.Ser119Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S L Tue Jun 30 16:58:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser119Leu' Q92947:p.Tyr155His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:10:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr155His' Q92947:p.Arg161Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 18:03:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg161Gln' Q92947:p.Pro217Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 18:48:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro217Leu' Q92947:p.Arg227Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 18:08:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg227Pro' Q92947:p.Gly244Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G C Tue Jun 30 19:47:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Cys' Q92947:p.Met263Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain M V Tue Jun 30 18:22:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Val' Q92947:p.Pro278Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P S Tue Jun 30 17:43:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro278Ser' Q92947:p.Arg355His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 19:38:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg355His' Q92947:p.Pro248Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 17:02:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro248Leu' proximity proximity close-contact colocalization neighbourhood interaction Figure S11, S12, Table 2a, 2b