UniProt UniProt http://www.uniprot.org ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer's Disease. ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer's Disease. EBioMedicine 2016 imex curation Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr Accepted 2020-JAN-15 AT 17:45 GMT AT 17:45 GMT by LUANA EBioMedicine 2016 Only protein-protein interactions imex curation imex curation ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer's Disease. ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer's Disease. EBioMedicine 2016 imex curation Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage tag fluorescence tag visualisation by fluorescence tag fluorescence Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr Accepted 2020-JAN-15 AT 17:45 GMT AT 17:45 GMT by LUANA EBioMedicine 2016 Only protein-protein interactions imex curation imex curation ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer's Disease. ADAM30 Downregulates APP-Linked Defects Through Cathepsin D Activation in Alzheimer's Disease. EBioMedicine 2016 imex curation Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr Accepted 2020-JAN-15 AT 17:45 GMT AT 17:45 GMT by LUANA EBioMedicine 2016 Only protein-protein interactions imex curation imex curation catd_human Cathepsin D CTSD CPSD protein protein human Homo sapiens Human MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL DIP protein P07339 original sequence version: null DIP protein P07339 original sequence version: 170 903FB8412E0CF0B0 ada30_human Disintegrin and metalloproteinase domain-containing protein 30 ADAM30 UNQ2509/PRO5997 protein protein human Homo sapiens Human MRSVQIFLSQCRLLLLLVPTMLLKSLGEDVIFHPEGEFDSYEVTIPEKLSFRGEVQGVVSPVSYLLQLKGKKHVLHLWPKRLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCMGGLRGVFNIDAKHYQIEPLKASPSFEHVVYLLKKEQFGNQVCGLSDDEIEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQRKYNDALAWSFGKVCSLEYAGSVSTLLDTNILAPATWSAHELGHAVGMSHDEQYCQCRGRLNCIMGSGRTGFSNCSYISFFKHISSGATCLNNIPGLGYVLKRCGNKIVEDNEECDCGSTEECQKDRCCQSNCKLQPGANCSIGLCCHDCRFRPSGYVCRQEGNECDLAEYCDGNSSSCPNDVYKQDGTPCKYEGRCFRKGCRSRYMQCQSIFGPDAMEAPSECYDAVNLIGDQFGNCEITGIRNFKKCESANSICGRLQCINVETIPDLPEHTTIISTHLQAENLMCWGTGYHLSMKPMGIPDLGMINDGTSCGEGRVCFKKNCVNSSVLQFDCLPEKCNTRGVCNNRKNCHCMYGWAPPFCEEVGYGGSIDSGPPGLLRGAIPSSIWVVSIIMFRLILLILSVVFVFFRQVIGNHLKPKQEKMPLSKAKTEQEESKTKTVQEESKTKTGQEESEAKTGQEESKAKTGQEESKANIESKRPKAKSVKKQKK mca-pro-leu-gly-leu-dpa-ala-arg-nh2 (7-Methoxycoumarin-4-yl)acetyl-Pro-Leu-Gly-Leu-N-3-(2, 4-Dinitrophenyl)-L-2,3-diaminopropionyl-Ala-Arg-NH2 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ctsd-mca_pro_leu_gly_leu_dpa_ala_arg_nh2-1 2 4 enzyme enzyme unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage Fig. 3B adam30-ctsd-1 2 5 enzyme regulator enzyme regulator ancillary ancillary purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKF2:p.[His338Leu;His342Leu;His348Leu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H L certain certain sequence position certain certain certain sequence position certain H L certain certain sequence position certain certain certain sequence position certain H L Tue Jun 30 20:02:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His338Leu;His342Leu;His348Leu]' ecoli Escherichia coli (strain K12) 4 enzyme enzyme unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 6 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage Fig. 3B adam30-ctsd-2 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 3C adam30-ctsd-3 3 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction Fig. 3C