IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of a Relatively Malignant Form of Osteopetrosis Caused by a Novel Mutation in the PLEKHM1 Gene. Characterization of a Relatively Malignant Form of Osteopetrosis Caused by a Novel Mutation in the PLEKHM1 Gene. Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2016 imex curation Bo T., Yan F., Guo J., Lin X., Zhang H., Guan Q., Wang H., Fang L., Gao L., Zhao J., Xu C. doctorxuchao@163.com 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bo T., Yan F., Guo J., Lin X., Zhang H., Guan Q., Wang H., Fang L., Gao L., Zhao J., Xu C. doctorxuchao@163.com Accepted 2019-SEP-16 AT 15:40 BST AT 15:40 BST by LUANA Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2016 Only protein-protein interactions imex curation imex curation Characterization of a Relatively Malignant Form of Osteopetrosis Caused by a Novel Mutation in the PLEKHM1 Gene. Characterization of a Relatively Malignant Form of Osteopetrosis Caused by a Novel Mutation in the PLEKHM1 Gene. Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2016 imex curation Bo T., Yan F., Guo J., Lin X., Zhang H., Guan Q., Wang H., Fang L., Gao L., Zhao J., Xu C. doctorxuchao@163.com 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Bo T., Yan F., Guo J., Lin X., Zhang H., Guan Q., Wang H., Fang L., Gao L., Zhao J., Xu C. doctorxuchao@163.com Accepted 2019-SEP-16 AT 15:40 BST AT 15:40 BST by LUANA Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2016 Only protein-protein interactions imex curation imex curation rab7a_human Ras-related protein Rab-7a RAB7A RAB7 protein protein human Homo sapiens Human MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC DIP protein P51149 original sequence version: 113 DIP protein P51149 original sequence version: 92 DIP protein P51149 original sequence version: 162 A2AF33B16A672971 pkhm1_human Pleckstrin homology domain-containing family M member 1 PLEKHM1 KIAA0356 162 kDa adapter protein protein protein human Homo sapiens Human MLSVVENGLDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIHGLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRAWLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSYKSAILNEWTLTPLALSGLCPLSELDPLSTSGAELQRKESLDSISHSSGSEDIEVHHSGHKIRRNQKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAEDSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAPAEPLPAQAASGTQDGVHVQEPRPQAPSPLDLQQPVESTSGQQPSSTVSETAREVGQGNGLQKAQAHDGAGLKLVVSSPTSPKNKSWISEDDFYRPSREQPLESASDHPIASYRGTPGSRPGLHRHFSQEPRKNCSLGALDQACVPSPGRRQAQAAPSQGHKSFRVVHRRQMGLSNPFRGLMKLGTVERRGAMGIWKELFCELSPLEFRLYLSNEEHTCVENCSLLRCESVGPAHSDGRFELVFSGKKLALRASSQDEAEDWLDRVREALQKVRPQQEDEWVNVQYPDQPEEPPEAPQGCLSPSDLLSEPAALQGTQFDWSSAQVPEPDAIKESLLYLYMDRTWMPYIFSLSLEALKCFRIRNNEKMLSDSHGVETIRDILPDTSLGGPSFFKIITAKAVLKLQAGNAEEAALWRDLVRKVLASYLETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPMEKGLDSQGCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA 24004093CFA89079 plekhm1-rab7a-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y4G2:p.Thr1018_Ala1056delinsSerGlnValCysArgValGlnAspArgLeuProProGluLeuProGlyCysGlyGluGluGlyLeuProProLeuCysProProAlaGlnValProGlyThrGluHisPheArgLeuMetProIleCys NP_055613.1:p.Thr1018SerfsTer44 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain TVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA SQVCRVQDRLPPELPGCGEEGLPPLCPPAQVPGTEHFRLMPIC Tue Jun 30 19:33:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1018_Ala1056delinsSerGlnValCysArgValGlnAspArgLeuProProGluLeuProGlyCysGlyGluGluGlyLeuProProLeuCysProProAlaGlnValProGlyThrGluHisPheArgLeuMetProIleCys' physical association physical association Fig. 4 plekhm1-rab7a-2 2 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y4G2:p.Thr1018_Ala1056delinsSerGlnValCysArgValGlnAspArgLeuProProGluLeuProGlyCysGlyGluGluGlyLeuProProLeuCysProProAlaGlnValProGlyThrGluHisPheArgLeuMetProIleCys NP_055613.1:p.Thr1018SerfsTer44 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain TVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA SQVCRVQDRLPPELPGCGEEGLPPLCPPAQVPGTEHFRLMPIC Tue Jun 30 17:49:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1018_Ala1056delinsSerGlnValCysArgValGlnAspArgLeuProProGluLeuProGlyCysGlyGluGluGlyLeuProProLeuCysProProAlaGlnValProGlyThrGluHisPheArgLeuMetProIleCys' colocalization colocalization Fig. 5