UniProt UniProt http://www.uniprot.org Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. The Journal of cell biology 2016 imex curation Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Control, sorf-1-/-, and sorf-2-/- animals Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn Accepted 2019-DEC-19 AT 09:51 GMT AT 09:51 GMT by PPORRAS The Journal of cell biology 2016 Only protein-protein interactions imex curation imex curation Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. The Journal of cell biology 2016 imex curation Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn Accepted 2019-DEC-19 AT 09:51 GMT AT 09:51 GMT by PPORRAS The Journal of cell biology 2016 Only protein-protein interactions imex curation imex curation Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. The Journal of cell biology 2016 imex curation Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn Accepted 2019-DEC-19 AT 09:51 GMT AT 09:51 GMT by PPORRAS The Journal of cell biology 2016 Only protein-protein interactions imex curation imex curation Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. The Journal of cell biology 2016 imex curation Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn Accepted 2019-DEC-19 AT 09:51 GMT AT 09:51 GMT by PPORRAS The Journal of cell biology 2016 Only protein-protein interactions imex curation imex curation Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. The Journal of cell biology 2016 imex curation Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn Accepted 2019-DEC-19 AT 09:51 GMT AT 09:51 GMT by PPORRAS The Journal of cell biology 2016 Only protein-protein interactions imex curation imex curation Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. Negative regulation of phosphatidylinositol 3-phosphate levels in early-to-late endosome conversion. The Journal of cell biology 2016 imex curation Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu K., Jian Y., Sun X., Yang C., Gao Z., Zhang Z., Liu X., Li Y., Xu J., Jing Y., Mitani S., He S., Yang C. Interactions involving mammalian BECN1 and PIK3C3 could not be added as the species of these constructs could not be traced clyang@genetics.ac.cn Accepted 2019-DEC-19 AT 09:51 GMT AT 09:51 GMT by PPORRAS The Journal of cell biology 2016 Only protein-protein interactions imex curation imex curation becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C wdr91_human WD repeat-containing protein 91 WDR91 HSPC049 protein protein human Homo sapiens Human MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLERRLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAEWKDWFVLPFLPSPDTNPTFATYFSRQWADTFIVSLHNFLSVLFQCMPVPVILNFDAECQRTNQVQEENEVLRQKLFALQAEIHRLKKEEQQPEEEEALVQHKLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQGPPQPQSSAKKESFGGQGTKGKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQCAEKKPEASGPEAEPCPELHTEPVEPLTRASSAGPEGGGVRPEQPFIVLGQEEYGEHHSSIMHCRVDCSGRRVASLDVDGVIKVWSFNPIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQQLQFSLDPEPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSWRAHYGEVYSVEFSYDENTVYSIGEDGKFIQWNIHKSGLKVSEYSLPSDATGPFVLSGYSGYKQVQVPRGRLFAFDSEGNYMLTCSATGGVIYKLGGDEKVLESCLSLGGHRAPVVTVDWSTAMDCGTCLTASMDGKIKLTTLLAHKA A93CF7F02D12629A becn_caeel Beclin homolog bec-1 atg-6 T19E7.3 protein protein caeel Caenorhabditis elegans MTTQRSHICLNCQHPLRLDFTQRRPDSADSEKKSETVITEALTGHSRNLMKLISDAQFPSDAPVCNDCSDALRNEMDAQVATLDDEIKTYQTYINYLKENHPTTSIPDLKAKLQNVSDEEKELEQQLKKLLAEEEQLDLDLQTKRRTAEAASEKSGELWKKYRDNLRQVFEDQDELHSLEAERQYAEVQHRKLTDTNVLDLCFHIWVDGIVGEINGFRLGYLKDAPVEFTEINAALGQIVLLLEILLERIGVQHHELMPVAMGSHSYIKLRRNGIDMETYALYGQGTPLSGSSGIDPGIRRFLQLLEFLLKELKDRNKNFKPPYQIHADSLVDNGVKYNAVMTLNTDVRWTRAMALMLTDLKAACAQCDALRSPI 630D0F04EEF324D8 sorf2_caeel Suppressor of organelle fusion 2 sorf-2 WD repeat-containing protein 81 homolog sorf-2 F52C9.1 protein protein caeel Caenorhabditis elegans MPEEEFEWNESKLNALSEILTQWAPHDELKLENVILEAKMAWIHESTDAVALEKEFEKLLNTSFDPLMDYEEHQRVKNGVCSPAKSTKLDWITKWANIAEKLSISHINCSKAPHKTINFQRLQILPNMTSILAIAHTEADNVILIYGHTKEGIDFQTVLRHSYSNIPDGSLQTIHFLTKNLLDLYSQLFSRKITAEFKTRHFRCLPSFWLQYDVLAPIFEQFRAPRAPRIPLDEATSNWANRKWENYQYLTYLNDITGRVRGEVHNHPIFPWVCDFSEENGGFRQLNRTKYRLCKGDDQLREMYSREPSHHVPELLSDIGYMVYRARVEPKDNLCRHVRRKWVPEEYPSTMSRMYQWTPDECIPEFYDDPSIFNSCHPDMADLRFPEFVSSPQEFIEWHRKMLEHEEVSMNLHRWIDLVFGFNLAIDNSKNALNLHLCFVEKNRRGLRTTGMVQLFNRPHPIRMPLNYDPKLDNYHLKMESFGFGMTSEHRKEPEVEPDEDSHYQIYQKIKKVRRLRHNTYFSSMVSAMEVMAQIVLAPHLAGRFDDPDHIRRCIQLYSYRIPANYRRLFDFLFNTEQDFPDCDEFSFFVSVRLNIPTKILNFSEEFGKCVSLHILRKLDVIPPFSKRSQLIILKEVESLKKSIRLCDHMEQCVVAAFQQLLEDEEACIQSVHRLMPVITRSLSQSALEDLINPMIELIQCETSVKLLDRRFLMHVSICYGTHTFLDLFLPPIVEACASMNCDRSVVAKESIMWLAKRYGPVICAKFISSNVLRIMASCYEAFEMVGLEQQPKAVFNVVLQGDETCSRIESLLSEIVLTYSVTFITVQFLPFCVDLIEQFHKRSSVQLEPGLVSVFRIVELSIRSMSDHQLMNYLEEFIIQKVIYRVLTILLDASFQFSSMRVRIIIICKVCQLLHSITQKIGTENTRIYANQPFKLMFSTFSEIYETDEELRINLRKRPSENTLFEVPLWMVEDVVDKFAKEWGVPFLSSFCDDPAFLIPFVSNSSSSSSPPASIAHSPPSAFTAYSLGGMSSGNRLFSLSASSPVNSVNSLGGLSFCDSGSLSAVWCARVSAAVCGVDNYRFDHLSLCNYTGHQEKIRKLAAISNENSFVSASSDKTVKLWSIKPELDEIGCQWTYQKHTRPVHDITILADNSIASTDGVLHVWDPFRTTLLAQMEWDSKEGSGGNIMRVENVDRHILSAICSLHSTVKLFDSRVGGWTCELKVSPGPGLTRAITVRDKGNKMAVALSNGTLAILDARNGKINALAQTNSTHTVSVNWLSDTRLLVCDADECGIFLETNPRAHIVRKLQDPVSAACLTDNSLVTLQNGTILRVYRNSGELQIETKIRPDELPGTPTAVLPLPLNCSYLIGSSHGAIRLMC 16286AD2F0D9D62F phosphatidylinositol 5-phosphate phosphatidylinositol 5-phosphate PI(5)P PtdIns5P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sorf1_caeel Suppressor of organelle fusion 1 sorf-1 ZK563.5 protein protein caeel Caenorhabditis elegans MSHVSNSTDEVVRNYLAAKSMVTSLKAFDQESSFAKEANYQVDRCIDEMTDAIDKHDVDTLCAMWESWNARVFHSLDTEGIKQAQCYEASAYRLFLVRCVQKKNISKCNEFFRKMSSLTLNNPQWADWFAFPYNHHAKDTEPFRKYFDKTWIEIYYVSLHNFLSTSLANVSPSVIGTIVEGIARDPTGNDHVDFDEDLIDDFAVIAQCSAPVKRGHSKPSLRNLLKSLTSSKKPSPSTD 6B63890EF96DDCFC phosphatidylinositol 4-phosphates phosphatidylinositol 4-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q8NEB9 original sequence version: 73 DIP protein Q8NEB9 original sequence version: 78 DIP protein Q8NEB9 original sequence version: 100 DIP protein Q8NEB9 original sequence version: 113 1C03D97338E44976 pk3c3_caeel Phosphatidylinositol 3-kinase catalytic subunit type 3 vps-34 let-512 B0025.1 Phosphoinositide-3-kinase class 3 protein protein caeel Caenorhabditis elegans MIPGMRATPTESFSFVYSCDLQTNVQVKVAEFEGIFRDVLNPVRRLNQLFAEITVYCNNQQIGYPVCTSFHTPPDSSQLARQKLIQKWNEWLTLPIRYSDLSRDAFLHITIWEHEDDEIVNNSTFSRRLVAQSKLSMFSKRGILKSGVIDVQMNVSTTPDPFVKQPETWKYSDAWGDEIDLLFKQVTRQSRGLVEDVPWLDPFASRRIEMIRAKYKYSSPDRHVFLVLEMAAIRLGPTFYKVVYYEDETKNMRVSTSVNGGVGIVSACTRYCVADPELLLESLAEVKHSAMTRRIRDVEDERHRQVKPNKQAKDRLETIVNLPSSQVLTREQRDLVWKFRHYLRQFPKALNKYLRSVNWVHPQEVKTALALMNDWELIEAEDALELLSSAFTHPAVRAYSVSRLLEAASPEQVLLYLPQLVQALKYEQGQQLPEEGNPVPVVSEEEGKIPSVATTPTEELEGRDMTVVTKKEARKAASGDLATFLIDYALASPKVSNYLYWHLKTEIESTKESKEEHSKMYQNIQDRLMEALVKRPDTRAQVDSLHQQQIFVEDLIILMNEAKARGGRLNESKSAEFRTMLSRAKHMLDLKGVHLPLDPSFRLSSVIPDTASFFKSEMMPAKISFKVLQPNGKADRNIPEEYTVIFKTGDDLRQDQLIQQMVRLIDIILKKGQLDLKLTPYLVLSTGVGQGFVQCIKSKPLRAIQEQYKAHKMDCIREAMKELRPGDGPFGIEPNVIDNYVRSLAGYSVIMYILGLGDRHLDNLLLCENGKLFHVDFGFILGRDPKPMPPPMKLTSEMVQVMGGVKSKQFLEFVQHVDSAYRILRRHSNVLLNLFSLMLDAGIPDIAAEPDKAIFKIEQRLRLDLSDEAATKHIFTQIESSLNAKMAMISDIIHAYKQNLM 3B490B64FD3F5E78 wdr81_human WD repeat-containing protein 81 WDR81 protein protein human Homo sapiens Human MAQGSGGREGALRTPAGGWHSPPSPDMQELLRSVERDLSIDPRQLAPAPGGTHVVALVPARWLASLRDRRLPLGPCPRAEGLGEAEVRTLLQRSVQRLPAGWTRVEVHGLRKRRLSYPLGGGLPFEDGSCGPETLTRFMQEVAAQNYRNLWRHAYHTYGQPYSHSPAPSAVPALDSVRQALQRVYGCSFLPVGETTQCPSYAREGPCPPRGSPACPSLLRAEALLESPEMLYVVHPYVQFSLHDVVTFSPAKLTNSQAKVLFILFRVLRAMDACHRQGLACGALSLYHIAVDEKLCSELRLDLSAYERPEEDENEEAPVARDEAGIVSQEEQGGQPGQPTGQEELRSLVLDWVHGRISNFHYLMQLNRLAGRRQGDPNYHPVLPWVVDFTTPHGRFRDLRKSKFRLNKGDKQLDFTYEMTRQAFVAGGAGGGEPPHVPHHISDVLSDITYYVYKARRTPRSVLCGHVRAQWEPHEYPASMERMQNWTPDECIPEFYTDPSIFRSIHPDMPDLDVPAWCSSSQEFVAAHRALLESREVSRDLHHWIDLTFGYKLQGKEAVKEKNVCLHLVDAHTHLASYGVVQLFDQPHPQRLAGAPALAPEPPLIPKLLVQTIQETTGREDFTENPGQLPNGVGRPVLEATPCEASWTRDRPVAGEDDLEQATEALDSISLAGKAGDQLGSSSQASPGLLSFSVASASRPGRRNKAAGADPGEGEEGRILLPEGFNPMQALEELEKTGNFLAKGLGGLLEVPEQPRVQPAVPLQCLLHRDMQALGVLLAEMVFATRVRTLQPDAPLWVRFQAVRGLCTRHPKEVPVSLQPVLDTLLQMSGPEVPMGAERGKLDQLFEYRPVSQGLPPPCPSQLLSPFSSVVPFPPYFPALHRFILLYQARRVEDEAQGRELVFALWQQLGAVLKDITPEGLEILLPFVLSLMSEEHTAVYTAWYLFEPVAKALGPKNANKYLLKPLIGAYESPCQLHGRFYLYTDCFVAQLMVRLGLQAFLTHLLPHVLQVLAGAEASQEESKDLAGAAEEEESGLPGAGPGSCAFGEEIPMDGEPPASSGLGLPDYTSGVSFHDQADLPETEDFQAGLYVTESPQPQEAEAVSLGRLSDKSSTSETSLGEERAPDEGGAPVDKSSLRSGDSSQDLKQSEGSEEEEEEEDSCVVLEEEEGEQEEVTGASELTLSDTVLSMETVVAGGSGGDGEEEEEALPEQSEGKEQKILLDTACKMVRWLSAKLGPTVASRHVARNLLRLLTSCYVGPTRQQFTVSSGESPPLSAGNIYQKRPVLGDIVSGPVLSCLLHIARLYGEPVLTYQYLPYISYLVAPGSASGPSRLNSRKEAGLLAAVTLTQKIIVYLSDTTLMDILPRISHEVLLPVLSFLTSLVTGFPSGAQARTILCVKTISLIALICLRIGQEMVQQHLSEPVATFFQVFSQLHELRQQDLKLDPAGRGEGQLPQVVFSDGQQRPVDPALLDELQKVFTLEMAYTIYVPFSCLLGDIIRKIIPNHELVGELAALYLESISPSSRNPASVEPTMPGTGPEWDPHGGGCPQDDGHSGTFGSVLVGNRIQIPNDSRPENPGPLGPISGVGGGGLGSGSDDNALKQELPRSVHGLSGNWLAYWQYEIGVSQQDAHFHFHQIRLQSFPGHSGAVKCVAPLSSEDFFLSGSKDRTVRLWPLYNYGDGTSETAPRLVYTQHRKSVFFVGQLEAPQHVVSCDGAVHVWDPFTGKTLRTVEPLDSRVPLTAVAVMPAPHTSITMASSDSTLRFVDCRKPGLQHEFRLGGGLNPGLVRALAISPSGRSVVAGFSSGFMVLLDTRTGLVLRGWPAHEGDILQIKAVEGSVLVSSSSDHSLTVWKELEQKPTHHYKSASDPIHTFDLYGSEVVTGTVSNKIGVCSLLEPPSQATTKLSSENFRGTLTSLALLPTKRHLLLGSDNGVIRLLA F6E62BC07FAAE8DB phosphatidylinositol-3-phosphate phosphatidylinositol 3-phosphate phosphatidylinositol 3-phosphates PI(3)P PtdIns3P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sorf_2-sorf_1-1 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain [EBI-21398594]The shifted ranges (451-1233) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-21398594]451-1233 [EBI-21398594]Q10122,3 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2E, 2G sorf_1-sorf_2-2 3 9 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 7F In pull-down assays, GST-fused BEC-1 pulled down 35S-labeled SORF-1, SORF-2, and VPS-34 (Fig. 7 F). sorf_2-bec_1-1 4 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7E bec_1-sorf_1-1 4 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7D sorf_1-sorf_2-1 6 10 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 12 unspecified role unspecified role bait bait purified purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 2F Likewise, maltose-binding protein (MBP)-fused SORF-1 pulled down 35S-labeled SORF-2 in vitro, suggesting a direct interaction between SORF-1 and SORF-2 (Fig. 2 F). bec_1-vps_34-1 1 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig.7G Interaction observed in sorf1-/- and sorf2-/- whole body lysates sorf_1-phosphatidylinositol_3_phosphate-1 5 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 7H, 7I sorf_1-phosphatidylinositol 4_phosphates-1 5 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 7H sorf_1-phosphatidylinositol 5_phosphate-1 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 7H becn1-21 2 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10A becn1-pik3c3-1 2 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10A Interaction observed in WDR81-/- cells becn1-pik3c3-2 2 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10A Interaction observed in WDR91-/- cells becn1-pik3c3-12 2 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 10B becn1-pik3c3-13 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10B becn1-pik3c3-14 2 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10B Interaction observed in WDR91-/- cells sorf_1-bec_1-1 4 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 5A sorf_2-bec_1-2 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 5B becn1-pik3c3-15 2 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10B wdr91-wdr81-1 4 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 5I bec_1-vps_34-2 3 15 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 7F In pull-down assays, GST-fused BEC-1 pulled down 35S-labeled SORF-1, SORF-2, and VPS-34 (Fig. 7 F). bec_1-sorf_1-2 3 9 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 7F In pull-down assays, GST-fused BEC-1 pulled down 35S-labeled SORF-1, SORF-2, and VPS-34 (Fig. 7 F). wdr91-bec_1-1 4 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 9E wdr81-bec_1-1 4 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 9D