IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MESP1 Mutations in Patients with Congenital Heart Defects. MESP1 Mutations in Patients with Congenital Heart Defects. Human mutation 2016 imex curation Werner P., Latney B., Deardorff MA., Goldmuntz E. Rare diseases - Interactions investigated in the context of Rare genetic disease Cardiac - Interactions involving cardiac related proteins goldmuntz@email.chop.edu 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. gal4 vp16 complement gal4 vp16 complementation karyoplasmic interaction ion strategy KISS mammalian two hybrid gal4 vp16 complement predetermined predetermined participant predetermined Werner P., Latney B., Deardorff MA., Goldmuntz E. Rare diseases - Interactions investigated in the context of Rare genetic disease Cardiac - Interactions involving cardiac related proteins goldmuntz@email.chop.edu Accepted 2019-NOV-13 AT 15:11 GMT AT 15:11 GMT by PPORRAS Human mutation 2016 Only protein-protein interactions imex curation imex curation mesp1_human Mesoderm posterior protein 1 Class C basic helix-loop-helix protein 5 MESP1 BHLHC5 protein protein human Homo sapiens Human MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVLALLETWMPLSPLEWLPEEPK 50508D4AF6EA7CE2 tfe2_human Transcription factor E2-alpha Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Immunoglobulin transcription factor 1 Transcription factor ITF-1 Kappa-E2-binding factor TCF3 E2A ITF1 BHLHB21 Class B basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM DIP protein P15923 original sequence version: 171 DIP protein P15923 original sequence version: 132 DIP protein P15923 original sequence version: 126 52F5E3DE1890AE13 mesp1-tcf3-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BRJ9:p.Gly70Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 17:29:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly70Asp' Q9BRJ9:p.Pro27_Asp29[2] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain PSD PSDPSD Wed Sep 18 13:43:18 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro27_Asp29dup' Wed Nov 13 12:31:31 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro27_Asp29dup' Fri Nov 15 17:50:30 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro27_Asp29dup' Tue Jun 30 20:02:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro27_Asp29[2]' Q9BRJ9:p.Lys268Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K N Tue Jun 30 18:22:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys268Asn' Q9BRJ9:p.Asp168Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D G Tue Jun 30 19:24:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp168Gly' Q9BRJ9:p.Glu104Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 16:22:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu104Lys' Q9BRJ9:p.Leu120Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 17:59:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu120Pro' Q9BRJ9:Leu147_Lys268delinsProAlaProValProAlaAlaArg NP_061140.1:p.Leu147Profs*9 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVLALLETWMPLSPLEWLPEEPK PAPVPAAR physical association physical association Figure 3