IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. PloS one 2014 imex curation Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl Accepted 2019-NOV-05 AT 13:19 GMT AT 13:19 GMT by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. PloS one 2014 imex curation Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl Accepted 2019-NOV-05 AT 13:19 GMT AT 13:19 GMT by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. PloS one 2014 imex curation Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay ms participant Identification by mass spectrometry ms participant Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl Accepted 2019-NOV-05 AT 13:19 GMT AT 13:19 GMT by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains. PloS one 2014 imex curation Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Glaza P., Osipiuk J., Wenta T., Zurawa-Janicka D., Jarzab M., Lesner A., Banecki B., Skorko-Glonek J., Joachimiak A., Lipinska B. Dear Checker; i have had lots of "odd" thing going on when curating this;please make sure there are no unexpected duplications of interactions. barbara.lipinska@biol.ug.edu.pl Accepted 2019-NOV-05 AT 13:19 GMT AT 13:19 GMT by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation maox_pig NADP-dependent malic enzyme Malic enzyme 1 ME1 protein protein pig Sus scrofa (Pig) Pig GYGLTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGPEYDDFLDEFMEAVSSKYGMNCLIQFEDFANINAFRLLKKYQNQYCTFNDDIQGTASVAVAGILAALRITKNKLSDQTILFQGAGEAALGIAHLIVMAMEKEGVPKEKAIKKIWLVDSKGLIVKGRAALTNEKEEFAHEHEEMKNLEAIVQDIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAERGYTLTQGRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVFPGVALAVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWPEEAQKIQTKLD 40692545F044BA99 htra3_human Serine protease HTRA3 HTRA3 PRSP High-temperature requirement factor A3 Pregnancy-related serine protease protein protein human Homo sapiens Human MQARALLLAALAALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPCGESLECVRGLCRCRWSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQREGRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM 3046FCDA1AB24FA6 casb_bovin Beta-casein CSN2 protein protein bovin Bos taurus (Bovine) Bovine MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV DIP protein P02666 original sequence version: 88 DIP protein P02666 original sequence version: 101 F0BBDD8148A238AE ala(mca)irrvsysf–anb–nh2 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) IRRVSYSF p83110-2 Serine protease HTRA3 HTRA3 PRSP High-temperature requirement factor A3 Pregnancy-related serine protease Short pS protein protein human Homo sapiens Human MQARALLLAALAALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPCGESLECVRGLCRCRWSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQREGRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQIKAPSLAVH 8A62D2B9823BC420 htra3-1 4 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P83110:p.Ser305Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:40:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser305Ala' ecoli Escherichia coli (strain K12) physical association physical association Table 3 3.27 A Free: 0.233 Working: 0.199 htra3-2 1 7 unspecified role unspecified role neutral component neutral component purified purified bovin-milk Bos taurus milk milk 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P83110:p.Ser305Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:53:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser305Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 7, Table 4 ala(mca)irrvsysfanbnh2-htra3-2 2 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 8, 9, Table 5 ala(mca)irrvsysfanbnh2-htra3-1 2 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_PDZ_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 8, 9, Table 5 ala(mca)irrvsysfanbnh2-htra3-3 2 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 8, Table 5 ala(mca)irrvsysfanbnh2-htra3-4 2 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified bovin-milk Bos taurus milk milk 6 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 8D,9 ala(mca)irrvsysfanbnh2-htra3-5 2 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified bovin-milk Bos taurus milk milk 6 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_PDZ_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 9A ala(mca)irrvsysfanbnh2-htra3-6 2 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 9A csn2-htra3-1 1 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P83110:p.Ser305Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:26:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser305Ala' PDZ_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 7, 10 csn2-htra3-2 3 6 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified bovin-milk Bos taurus milk milk protein cleavage protein cleavage Figure 11,12 csn2-htra3-5 3 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 6 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figure 11,12