DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Architecture of the ubiquitylation module of the yeast Ccr4-Not complex. Architecture of the ubiquitylation module of the yeast Ccr4-Not complex. Structure (London, England : 1993) 2015 imex curation Bhaskar V., Basquin J., Conti E., Bhaskar V., Basquin J., Conti E. conti@biochem.mpg.de 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Bhaskar V., Basquin J., Conti E., Bhaskar V., Basquin J., Conti E. conti@biochem.mpg.de Accepted 2019-SEP-23 AT 12:27 BST AT 12:27 BST by ORCHARD Structure (London, England : 1993) 2015 imex curation Architecture of the ubiquitylation module of the yeast Ccr4-Not complex. Architecture of the ubiquitylation module of the yeast Ccr4-Not complex. Structure (London, England : 1993) 2015 imex curation Bhaskar V., Basquin J., Conti E., Bhaskar V., Basquin J., Conti E. conti@biochem.mpg.de 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Bhaskar V., Basquin J., Conti E., Bhaskar V., Basquin J., Conti E. Coordinates of NOT5C taken from PMID:24121231 conti@biochem.mpg.de Accepted 2019-SEP-23 AT 12:27 BST AT 12:27 BST by ORCHARD Structure (London, England : 1993) 2015 imex curation Architecture of the ubiquitylation module of the yeast Ccr4-Not complex. Architecture of the ubiquitylation module of the yeast Ccr4-Not complex. Structure (London, England : 1993) 2015 imex curation Bhaskar V., Basquin J., Conti E., Bhaskar V., Basquin J., Conti E. conti@biochem.mpg.de 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column ms participant Identification by mass spectrometry ms participant Bhaskar V., Basquin J., Conti E., Bhaskar V., Basquin J., Conti E. conti@biochem.mpg.de Accepted 2019-SEP-23 AT 12:27 BST AT 12:27 BST by ORCHARD Structure (London, England : 1993) 2015 imex curation not4_yeast General negative regulator of transcription subunit 4 MOT2 CCL1 NOT4 SIG1 SSF1 Modulator of transcription 2 YER068W protein protein yeast Saccharomyces cerevisiae Baker's yeast MMNPHVQENLQAIHNALSNFDTSFLSEDEEDYCPLCIEPMDITDKNFFPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDENVRYVTLSPEELKMERAKLARKEKERKHREKERKENEYTNRKHLSGTRVIQKNLVYVVGINPPVPYEEVAPTLKSEKYFGQYGKINKIVVNRKTPHSNNTTSEHYHHHSPGYGVYITFGSKDDAARCIAQVDGTYMDGRLIKAAYGTTKYCSSYLRGLPCPNPNCMFLHEPGEEADSFNKRELHNKQQAQQQSGGTAFTRSGIHNNISTSTAGSNTNLLSENFTGTPSPAAMRAQLHHDSHTNAGTPVLTPAPVPAGSNPWGVTQSATPVTSINLSKNSSSINLPTLNDSLGHHTTPTTENTITSTTTTTNTNATSHSHGSKKKQSLAAEEYKDPYDALGNAVDFLDARLHSLSNYQKRPISIKSNIIDEETYKKYPSLFSWDKIEASKKSDNTLANKLVEILAIKPIDYTASVVQFLQSVNVGVNDNITITDNTKTPTQPIRLQTVSQQIQPPLNVSTPPPGIFGPQHKVPIQQQQMGDTSSRNSSDLLNQLINGRKIIAGN 8847084BD9BF48B7 8847084BD9BF48B7 not1_yeast General negative regulator of transcription subunit 1 CDC39 NOT1 ROS1 YCR093W YCR93W YCR1151 Cell division cycle protein 39 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSATYRDLNTASNLETSKEKQAAQIVIAQISLLFTTLNNDNFESVEREIRHILDRSSVDIYIKVWERLLTLSSRDILQAGKFLLQENLLHRLLLEFAKDLPKKSTDLIELLKERTFNNQEFQKQTGITLSLFIDLFDKSANKDIIESLDRSSQINDFKTIKMNHTNYLRNFFLQTTPETLESNLRDLLHSLEGESLNDLLALLLSEILSPGSQNLQNDPTRSWLTPPMVLDATNRGNVIARSISSLQANQINWNRVFNLMSTKYFLSAPLMPTTASLSCLFAALHDGPVIDEFFSCDWKVIFKLDLAIQLHKWSVQNGCFDLLNAEGTRKVSETIPNTKQSLLYLLSIASLNLELFLQREELSDGPMLAYFQECFFEDFNYAPEYLILALVKEMKRFVLLIENRTVIDEILITLLIQVHNKSPSSFKDVISTITDDSKIVDAAKIIINSDDAPIANFLKSLLDTGRLDTVINKLPFNEAFKILPCARQIGWEGFDTFLKTKVSPSNVDVVLESLEVQTKMTDTNTPFRSLKTFDLFAFHSLIEVLNKCPLDVLQLQRFESLEFSLLIAFPRLINFGFGHDEAILANGDIAGINNDIEKEMQNYLQKMYSGELAIKDVIELLRRLRDSDLPRDQEVFTCITHAVIAESTFFQDYPLDALATTSVLFGSMILFQLLRGFVLDVAFRIIMRFAKEPPESKMFKFAVQAIYAFRIRLAEYPQYCKDLLRDVPALKSQAQVYQSIVEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINTPEVIETLSGALGSITLEQQQTEQQRQIILMQQHQQQMLIYQQRQQQQQQRQQQQQHHISANTIADQQAAFGGEGSISHDNPFNNLLGSTIFVTHPDLKRVFQMALAKSVREILLEVVEKSSGIAVVTTTKIILKDFATEVDESKLKTAAIIMVRHLAQSLARATSIEPLKEGIRSTMQSLAPNLMSLSSSPAEELDTAINENIGIALVLIEKASMDKSTQDLADQLMQAIAIRRYHKERRADQPFITQNTNPYSLSLPEPLGLKNTGVTPQQFRVYEEFGKNIPNLDVIPFAGLPAHAPPMTQNVGLTQPQQQQAQMPTQILTSEQIRAQQQQQQLQKSRLNQPSQSAQPPGVNVPNPQGGIAAVQSDLEQNQRVLVHLMDILVSQIKENATKNNLAELGDQNQIKTIIFQILTFIAKSAQKDQLALKVSQAVVNSLFATSESPLCREVLSLLLEKLCSLSLVARKDVVWWLVYALDSRKFNVPVIRSLLEVNLIDATELDNVLVTAMKNKMENSTEFAMKLIQNTVLSDDPILMRMDFIKTLEHLASSEDENVKKFIKEFEDTKIMPVRKGTKTTRTEKLYLVFTEWVKLLQRVENNDVITTVFIKQLVEKGVISDTDNLLTFVKSSLELSVSSFKESDPTDEVFIAIDALGSLIIKLLILQGFKDDTRRDYINAIFSVIVLVFAKDHSQEGTTFNERPYFRLFSNILYEWATIRTHNFVRISDSSTRQELIEFDSVFYNTFSGYLHALQPFAFPGFSFAWVTLLSHRMLLPIMLRLPNKIGWEKLMLLIIDLFKFLDQYTSKHAVSDAVSVVYKGTLRVILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILSAIPKNMTVPNPYDVDLNMEDIPACKELPEVFFDPVIDLHSLKKPVDNYLRIPSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEYKRTSSNAVFNTKSSYYTLLFNLIQNGSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMFKSDEWNDQKLEVQEIILRNFLKRIIVNKPHTWGVSVFFTQLINNNDINLLDLPFVQSVPEIKLILQQLVKYSKKYTTSEQDDQSATINRRQTPLQSNA 5B2AE15BCF95E009 5B2AE15BCF95E009 ubc4_yeast Ubiquitin-conjugating enzyme E2 4 UBC4 YBR082C YBR0745 Ubiquitin-protein ligase 4 Ubiquitin carrier protein 4 E2 ubiquitin-conjugating enzyme 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 8E96137D3EB20F80 8E96137D3EB20F80 not5_yeast General negative regulator of transcription subunit 5 NOT5 YP9499.27 YPR072W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLESDLKREIKKLQKHRDQIKTWLSKEDVKDKQSVLMTNRRLIENGMERFKSVEKLMKTKQFSKEALTNPDIIKDPKELKKRDQVLFIHDCLDELQKQLEQYEAQENEEQTERHEFHIANLENILKKLQNNEMDPEPVEEFQDDIKYYVENNDDPDFIEYDTIYEDMGCEIQPSSSNNEAPKEGNNQTSLSSIRSSKKQERSPKKKAPQRDVSISDRATTPIAPGVESASQSISSTPTPVSTDTPLHTVKDDSIKFDNSTLGTPTTHVSMKKKESENDSEQQLNFPPDRTDEIRKTIQHDVETNAAFQNPLFNDELKYWLDSKRYLMQPLQEMSPKMVSQLESSLLNCPDSLDADSPCLYTKPLSLPHPTSIFFPNEPIRFVYPYDVPLNLTNNENDTDNKFGKDSKAKSKKDDDIYSRTSLARIFMKFDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKEIEKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYNEEDFEKL 073137119B3E92BC 073137119B3E92BC not2_yeast General negative regulator of transcription subunit 2 CDC36 DNA19 NOT2 YDL165W cell division cycle protein 36 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 7D0B69657F791371 7D0B69657F791371 x-ray diffraction-8 1 6 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Binding Region Binding Region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1 B&C. Table 1 x-ray diffraction-9 1 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2C Table 1 mot2-cdc39-2 2 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified Not4C-N Not4C-N sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2B, 3D, 3E, 4B mot2-cdc36-1 2 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Figure 4B cdc39-mot2-1 3 4 ms participant Identification by mass spectrometry ms participant partial id prot seq partial identification of protein sequence partial id prot seq experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 ms participant Identification by mass spectrometry ms participant partial id prot seq partial identification of protein sequence partial id prot seq experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig S2 not5-cdc36-1 2 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig 2B mot2-cdc39-1 2 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Not4 binding region Not4 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P34909:p.Leu463_Phe464delinsGluGlu L463E F464E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LF EE Wed Sep 18 12:59:57 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu463Glu;Phe464Glu' Tue Jun 30 20:17:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu463_Phe464delinsGluGlu' P34909:p.[Phe464Glu;Trp466Glu] F464E;W466E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain W E Wed Sep 18 13:42:59 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe464Glu;Trp466Glu' Tue Jun 30 17:54:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe464Glu;Trp466Glu]' ecoli Escherichia coli (strain K12) 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3E