DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor α with liver X receptor α. Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor α with liver X receptor α. Biochemistry 2014 imex curation Balanarasimha M., Davis AM., Soman FL., Rider SD., Hostetler HA. heather.hostetler@wright.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cd circular dichroism CD CD cd weight by comassie molecular weight estimation by coomasie staining weight by comassie Balanarasimha M., Davis AM., Soman FL., Rider SD., Hostetler HA. heather.hostetler@wright.edu Accepted 2019-JUL-04 AT 11:31 BST AT 11:31 BST by ORCHARD Biochemistry 2014 imex curation Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor α with liver X receptor α. Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor α with liver X receptor α. Biochemistry 2014 imex curation Balanarasimha M., Davis AM., Soman FL., Rider SD., Hostetler HA. heather.hostetler@wright.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Balanarasimha M., Davis AM., Soman FL., Rider SD., Hostetler HA. heather.hostetler@wright.edu Accepted 2019-JUL-04 AT 11:31 BST AT 11:31 BST by ORCHARD Biochemistry 2014 imex curation Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor α with liver X receptor α. Ligand-regulated heterodimerization of peroxisome proliferator-activated receptor α with liver X receptor α. Biochemistry 2014 imex curation Balanarasimha M., Davis AM., Soman FL., Rider SD., Hostetler HA. heather.hostetler@wright.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence fluorescence technology fluorescence weight by comassie molecular weight estimation by coomasie staining weight by comassie Balanarasimha M., Davis AM., Soman FL., Rider SD., Hostetler HA. heather.hostetler@wright.edu Accepted 2019-JUL-04 AT 11:31 BST AT 11:31 BST by ORCHARD Biochemistry 2014 imex curation ppara_human Peroxisome proliferator-activated receptor alpha PPARA NR1C1 PPAR Nuclear receptor subfamily 1 group C member 1 protein protein human Homo sapiens Human MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY 850846FD51ADA883 nr1h3_human Oxysterols receptor LXR-alpha Liver X receptor alpha Nuclear receptor subfamily 1 group H member 3 NR1H3 LXRA protein protein human Homo sapiens Human MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE 0D27B237440F8C9C nr1h3-ppara-2 1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2A,B, FIgure 5, Table 2 nr1h3-ppara-3 3 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified cy5 label cy5 label cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3A, Figure 6 nr1h3-ppara-4 3 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified cy3 label cy3 label cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3B ppara-nr1h3-2 2 5 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level native native human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). 4 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level native native human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). physical association physical association Figure 4, column 1 nr1h3-ppara-5 2 5 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level native native human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). 4 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level native native human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). physical association physical association Figure 4, column 2